@database AmigaEMessages @node main "Messages LIST" @{fg shine} Amiga E Mailing List November 1998 Messages @{fg text} @{" Read Me First! " LINK readme} @{" How to subscribe to AmigaE Mailing List " LINK subscribe} @{" Author " LINK author} ================================================================== @{fg shine}MUI OM_GET Method@{fg text} @{" MUI OM_GET Method " LINK ID58_0} @{fg shine}INet225@{fg text} @{" INet225 " LINK ID57_0} @{fg shine}Program output@{fg text} @{" Program output " LINK ID56_0} @{" Program output " LINK ID56_1} @{fg shine}Bitmap palette remapping@{fg text} @{" Bitmap palette remapping " LINK ID55_0} @{fg shine}Old ideas - Java@{fg text} @{" Old ideas - Java " LINK ID54_0} @{" Old ideas - Java " LINK ID54_1} @{" Old ideas - Java " LINK ID54_2} @{" Old ideas - Java " LINK ID54_3} @{fg shine}Old ideas - Syntax@{fg text} @{" Old ideas - Syntax " LINK ID53_0} @{fg shine}Old ideas - assembly ?@{fg text} @{" Old ideas - assembly ? " LINK ID52_0} @{" Old ideas - assembly ? " LINK ID52_1} @{" Old ideas - assembly ? " LINK ID52_2} @{" Old ideas - assembly ? " LINK ID52_3} @{" Old ideas - assembly ? " LINK ID52_4} @{" Old ideas - assembly ? " LINK ID52_5} @{" Old ideas - assembly ? " LINK ID52_6} @{" Old ideas - assembly ? " LINK ID52_7} @{" Old ideas - assembly ? " LINK ID52_8} @{" Old ideas - assembly ? " LINK ID52_9} @{" Old ideas - assembly ? " LINK ID52_10} @{fg shine}THANK YOU ALL !!!@{fg text} @{" THANK YOU ALL !!! " LINK ID51_0} @{" THANK YOU ALL !!! " LINK ID51_1} @{fg shine}Old ideas - Frontend@{fg text} @{" Old ideas - Frontend " LINK ID50_0} @{fg shine}MuiCursor@{fg text} @{" MuiCursor " LINK ID49_0} @{fg shine}NewIcon copy!@{fg text} @{" NewIcon copy! " LINK ID48_0} @{fg shine}Problem with IF/ELSEIF@{fg text} @{" Problem with IF/ELSEIF " LINK ID47_0} @{" Problem with IF/ELSEIF " LINK ID47_1} @{" Problem with IF/ELSEIF " LINK ID47_2} @{" Problem with IF/ELSEIF " LINK ID47_3} @{" Problem with IF/ELSEIF " LINK ID47_4} @{" Problem with IF/ELSEIF " LINK ID47_5} @{fg shine}Kicking myself in public (was: EasyGUI/E problem, or something@{fg text} @{" Kicking myself in public (was: EasyGUI/E problem, or something " LINK ID46_0} @{" Kicking myself in public (was: EasyGUI/E problem, or something " LINK ID46_1} @{" Kicking myself in public (was: EasyGUI/E problem, or something " LINK ID46_2} @{" Kicking myself in public (was: EasyGUI/E problem, or something " LINK ID46_3} @{fg shine}E Objects@{fg text} @{" E Objects " LINK ID45_0} @{" E Objects " LINK ID45_1} @{" E Objects " LINK ID45_2} @{" E Objects " LINK ID45_3} @{" E Objects " LINK ID45_4} @{fg shine}Bitmap blitting and backfill hooks@{fg text} @{" Bitmap blitting and backfill hooks " LINK ID44_0} @{" Bitmap blitting and backfill hooks " LINK ID44_1} @{" Bitmap blitting and backfill hooks " LINK ID44_2} @{fg shine}gui problem@{fg text} @{" gui problem " LINK ID43_0} @{fg shine}AmigaCentral.com - Is Now Open - http://www.amigacentral.com@{fg text} @{" AmigaCentral.com - Is Now Open - http://www.amigacentral.com " LINK ID42_0} @{fg shine}Subjects@{fg text} @{" Subjects " LINK ID41_0} @{" Subjects " LINK ID41_1} @{" Subjects " LINK ID41_2} @{" Subjects " LINK ID41_3} @{" Subjects " LINK ID41_4} @{" Subjects " LINK ID41_5} @{" Subjects " LINK ID41_6} @{" Subjects " LINK ID41_7} @{" Subjects " LINK ID41_8} @{" Subjects " LINK ID41_9} @{fg shine}Old ideas (was: Lacking features)@{fg text} @{" Old ideas (was: Lacking features) " LINK ID40_0} @{" Old ideas (was: Lacking features) " LINK ID40_1} @{" Old ideas (was: Lacking features) " LINK ID40_2} @{" Old ideas (was: Lacking features) " LINK ID40_3} @{" Old ideas (was: Lacking features) " LINK ID40_4} @{" Old ideas (was: Lacking features) " LINK ID40_5} @{" Old ideas (was: Lacking features) " LINK ID40_6} @{" Old ideas (was: Lacking features) " LINK ID40_7} @{" Old ideas (was: Lacking features) " LINK ID40_8} @{" Old ideas (was: Lacking features) " LINK ID40_9} @{" Old ideas (was: Lacking features) " LINK ID40_10} @{" Old ideas (was: Lacking features) " LINK ID40_11} @{" Old ideas (was: Lacking features) " LINK ID40_12} @{" Old ideas (was: Lacking features) " LINK ID40_13} @{" Old ideas (was: Lacking features) " LINK ID40_14} @{" Old ideas (was: Lacking features) " LINK ID40_15} @{" Old ideas (was: Lacking features) " LINK ID40_16} @{" Old ideas (was: Lacking features) " LINK ID40_17} @{" Old ideas (was: Lacking features) " LINK ID40_18} @{" Old ideas (was: Lacking features) " LINK ID40_19} @{fg shine}MUI gadget/group cycling@{fg text} @{" MUI gadget/group cycling " LINK ID39_0} @{" MUI gadget/group cycling " LINK ID39_1} @{" MUI gadget/group cycling " LINK ID39_2} @{fg shine}MUI Listviews And MUI Arexx@{fg text} @{" MUI Listviews And MUI Arexx " LINK ID38_0} @{fg shine}Debug messages@{fg text} @{" Debug messages " LINK ID37_0} @{" Debug messages " LINK ID37_1} @{" Debug messages " LINK ID37_2} @{fg shine}MUI, Arexx And Listviews@{fg text} @{" MUI, Arexx And Listviews " LINK ID36_0} @{" MUI, Arexx And Listviews " LINK ID36_1} @{fg shine}Rexx Scripts@{fg text} @{" Rexx Scripts " LINK ID35_0} @{" Rexx Scripts " LINK ID35_1} @{" Rexx Scripts " LINK ID35_2} @{fg shine}Little ARexx port shutdown query@{fg text} @{" Little ARexx port shutdown query " LINK ID34_0} @{" Little ARexx port shutdown query " LINK ID34_1} @{" Little ARexx port shutdown query " LINK ID34_2} @{" Little ARexx port shutdown query " LINK ID34_3} @{" Little ARexx port shutdown query " LINK ID34_4} @{" Little ARexx port shutdown query " LINK ID34_5} @{" Little ARexx port shutdown query " LINK ID34_6} @{" Little ARexx port shutdown query " LINK ID34_7} @{" Little ARexx port shutdown query " LINK ID34_8} @{" Little ARexx port shutdown query " LINK ID34_9} @{" Little ARexx port shutdown query " LINK ID34_10} @{" Little ARexx port shutdown query " LINK ID34_11} @{" Little ARexx port shutdown query " LINK ID34_12} @{" Little ARexx port shutdown query " LINK ID34_13} @{" Little ARexx port shutdown query " LINK ID34_14} @{fg shine}Closing Libraries built with E@{fg text} @{" Closing Libraries built with E " LINK ID33_0} @{" Closing Libraries built with E " LINK ID33_1} @{" Closing Libraries built with E " LINK ID33_2} @{" Closing Libraries built with E " LINK ID33_3} @{" Closing Libraries built with E " LINK ID33_4} @{" Closing Libraries built with E " LINK ID33_5} @{" Closing Libraries built with E " LINK ID33_6} @{" Closing Libraries built with E " LINK ID33_7} @{" Closing Libraries built with E " LINK ID33_8} @{" Closing Libraries built with E " LINK ID33_9} @{" Closing Libraries built with E " LINK ID33_10} @{" Closing Libraries built with E " LINK ID33_11} @{" Closing Libraries built with E " LINK ID33_12} @{fg shine}Loudmouth v1.0@{fg text} @{" Loudmouth v1.0 " LINK ID32_0} @{" Loudmouth v1.0 " LINK ID32_1} @{" Loudmouth v1.0 " LINK ID32_2} @{" Loudmouth v1.0 " LINK ID32_3} @{" Loudmouth v1.0 " LINK ID32_4} @{" Loudmouth v1.0 " LINK ID32_5} @{" Loudmouth v1.0 " LINK ID32_6} @{" Loudmouth v1.0 " LINK ID32_7} @{" Loudmouth v1.0 " LINK ID32_8} @{" Loudmouth v1.0 " LINK ID32_9} @{" Loudmouth v1.0 " LINK ID32_10} @{" Loudmouth v1.0 " LINK ID32_11} @{fg shine}UU Encoding@{fg text} @{" UU Encoding " LINK ID31_0} @{" UU Encoding " LINK ID31_1} @{fg shine}E libraries and arexx@{fg text} @{" E libraries and arexx " LINK ID30_0} @{" E libraries and arexx " LINK ID30_1} @{" E libraries and arexx " LINK ID30_2} @{" E libraries and arexx " LINK ID30_3} @{" E libraries and arexx " LINK ID30_4} @{" E libraries and arexx " LINK ID30_5} @{" E libraries and arexx " LINK ID30_6} @{" E libraries and arexx " LINK ID30_7} @{" E libraries and arexx " LINK ID30_8} @{" E libraries and arexx " LINK ID30_9} @{" E libraries and arexx " LINK ID30_10} @{fg shine}MUI Listtree programming ??@{fg text} @{" MUI Listtree programming ?? " LINK ID29_0} @{fg shine}ECLASS_ACTIVEWINDOW@{fg text} @{" ECLASS_ACTIVEWINDOW " LINK ID28_0} @{" ECLASS_ACTIVEWINDOW " LINK ID28_1} @{" ECLASS_ACTIVEWINDOW " LINK ID28_2} @{" ECLASS_ACTIVEWINDOW " LINK ID28_3} @{" ECLASS_ACTIVEWINDOW " LINK ID28_4} @{fg shine}socket.library@{fg text} @{" socket.library " LINK ID27_0} @{fg shine}Audio Module@{fg text} @{" Audio Module " LINK ID26_0} @{" Audio Module " LINK ID26_1} @{fg shine}EasyGUI: dynamic definition?@{fg text} @{" EasyGUI: dynamic definition? " LINK ID25_0} @{" EasyGUI: dynamic definition? " LINK ID25_1} @{" EasyGUI: dynamic definition? " LINK ID25_2} @{" EasyGUI: dynamic definition? " LINK ID25_3} @{fg shine}IECLASS_ACTIVEWINDOW@{fg text} @{" IECLASS_ACTIVEWINDOW " LINK ID24_0} @{" IECLASS_ACTIVEWINDOW " LINK ID24_1} @{" IECLASS_ACTIVEWINDOW " LINK ID24_2} @{" IECLASS_ACTIVEWINDOW " LINK ID24_3} @{fg shine}(no subject)@{fg text} @{" (no subject) " LINK ID23_0} @{fg shine}HELP HELP HELP@{fg text} @{" HELP HELP HELP " LINK ID22_0} @{" HELP HELP HELP " LINK ID22_1} @{" HELP HELP HELP " LINK ID22_2} @{" HELP HELP HELP " LINK ID22_3} @{" HELP HELP HELP " LINK ID22_4} @{" HELP HELP HELP " LINK ID22_5} @{" HELP HELP HELP " LINK ID22_6} @{" HELP HELP HELP " LINK ID22_7} @{" HELP HELP HELP " LINK ID22_8} @{" HELP HELP HELP " LINK ID22_9} @{" HELP HELP HELP " LINK ID22_10} @{" HELP HELP HELP " LINK ID22_11} @{" HELP HELP HELP " LINK ID22_12} @{fg shine}UU encoding@{fg text} @{" UU encoding " LINK ID21_0} @{fg shine}Debugging help for ARexxComm needed!@{fg text} @{" Debugging help for ARexxComm needed! " LINK ID20_0} @{fg shine}3D scrolling gadget knob@{fg text} @{" 3D scrolling gadget knob " LINK ID19_0} @{fg shine}MUI-BodyChunk Objects@{fg text} @{" MUI-BodyChunk Objects " LINK ID18_0} @{" MUI-BodyChunk Objects " LINK ID18_1} @{fg shine}Problems with c--e converting@{fg text} @{" Problems with c--e converting " LINK ID17_0} @{" Problems with c--e converting " LINK ID17_1} @{fg shine}Lacking features (was Problems with c->e converting)@{fg text} @{" Lacking features (was Problems with c->e converting) " LINK ID16_0} @{" Lacking features (was Problems with c->e converting) " LINK ID16_1} @{" Lacking features (was Problems with c->e converting) " LINK ID16_2} @{" Lacking features (was Problems with c->e converting) " LINK ID16_3} @{fg shine}GACT_IMMEDIATE buttons in EasyGUI?@{fg text} @{" GACT_IMMEDIATE buttons in EasyGUI? " LINK ID15_0} @{fg shine}Problems with c->e converting@{fg text} @{" Problems with c->e converting " LINK ID14_0} @{" Problems with c->e converting " LINK ID14_1} @{" Problems with c->e converting " LINK ID14_2} @{" Problems with c->e converting " LINK ID14_3} @{" Problems with c->e converting " LINK ID14_4} @{" Problems with c->e converting " LINK ID14_5} @{" Problems with c->e converting " LINK ID14_6} @{" Problems with c->e converting " LINK ID14_7} @{fg shine}UUEncode/Decode Src@{fg text} @{" UUEncode/Decode Src " LINK ID13_0} @{fg shine}-none-@{fg text} @{" -none- " LINK ID12_0} @{fg shine}@{fg text} @{" " LINK ID11_0} @{" " LINK ID11_1} @{" " LINK ID11_2} @{" " LINK ID11_3} @{fg shine}OBJECTS and getting the size of data@{fg text} @{" OBJECTS and getting the size of data " LINK ID10_0} @{fg shine}CSV to guide problem@{fg text} @{" CSV to guide problem " LINK ID9_0} @{" CSV to guide problem " LINK ID9_1} @{" CSV to guide problem " LINK ID9_2} @{" CSV to guide problem " LINK ID9_3} @{fg shine}Another small survey@{fg text} @{" Another small survey " LINK ID8_0} @{" Another small survey " LINK ID8_1} @{" Another small survey " LINK ID8_2} @{" Another small survey " LINK ID8_3} @{" Another small survey " LINK ID8_4} @{" Another small survey " LINK ID8_5} @{" Another small survey " LINK ID8_6} @{" Another small survey " LINK ID8_7} @{" Another small survey " LINK ID8_8} @{" Another small survey " LINK ID8_9} @{fg shine}MUI problem@{fg text} @{" MUI problem " LINK ID7_0} @{" MUI problem " LINK ID7_1} @{fg shine}subscribe?@{fg text} @{" subscribe? " LINK ID6_0} @{fg shine}Audio questions@{fg text} @{" Audio questions " LINK ID5_0} @{" Audio questions " LINK ID5_1} @{" Audio questions " LINK ID5_2} @{" Audio questions " LINK ID5_3} @{" Audio questions " LINK ID5_4} @{fg shine}EasyGUI/E problem, or something larger?@{fg text} @{" EasyGUI/E problem, or something larger? " LINK ID4_0} @{" EasyGUI/E problem, or something larger? " LINK ID4_1} @{fg shine}RemoveGList problems@{fg text} @{" RemoveGList problems " LINK ID3_0} @{fg shine}AMarquee@{fg text} @{" AMarquee " LINK ID2_0} @{" AMarquee " LINK ID2_1} @{" AMarquee " LINK ID2_2} @{" AMarquee " LINK ID2_3} @{" AMarquee " LINK ID2_4} @{" AMarquee " LINK ID2_5} @{" AMarquee " LINK ID2_6} @{" AMarquee " LINK ID2_7} @{" AMarquee " LINK ID2_8} @{" AMarquee " LINK ID2_9} @{" AMarquee " LINK ID2_10} @{" AMarquee " LINK ID2_11} @{" AMarquee " LINK ID2_12} @{" AMarquee " LINK ID2_13} @{" AMarquee " LINK ID2_14} @{" AMarquee " LINK ID2_15} @{" AMarquee " LINK ID2_16} @{fg shine}UNSUBSCRIBE@{fg text} @{" UNSUBSCRIBE " LINK ID1_0} @{" UNSUBSCRIBE " LINK ID1_1} @{fg shine}easygui.library - on the way, help needed :)@{fg text} @{" easygui.library - on the way, help needed :) " LINK ID0_0} @{" easygui.library - on the way, help needed :) " LINK ID0_1} @endnode @node readme "Read Me First!" @{fg shine} Introduction @{fg text} Here you'll find all the messages appeared on Amiga E Mailing list in November 1998. This is the first version of the message log done in Amiga Guide. I have just written a little program to do this, as soon as I can create some comments, I'll release it in the public domain. The best way of reading this guide is to choose an argument (ie. a subject of a message) and then browse it using the "Previous" and "Next" gadget in the MultiView/AmigaGuide viewer. @endnode @node author "Author" @{fg shine} Author @{fg text} Err.. authors of this text are Amiga E subscribers! Anyway, I have packed it all. My name is Fabio Rotondo. If you want to contact me, please, write to: Fabio Rotondo - email: fsoft@intercom.it Fabio.Rotondo@deagostini.it Via Lunga, 50 27020 Valle Lomellina (PV) ITALY @endnode @node subscribe "How to subscribe to AmigaE Mailing List" @{fg shine}How to subscribe to AmigaE Mailing List @{fg text} To subscribe to the @{fg shine}official@{fg text} AmigaE Mailing list, please, write to: listserv@intercom.it with: SUBSCRIBE amigae-list First LastName in the @{fg shine}BODY@{fg text} of the message. Eg. SUBSCRIBE amigae-list John Smith To unsubscribe, write to: listserv@intercom.it with: SIG amigae-list in the @{fg shine}BODY@{fg text} of the message. @endnode @node ID0_0 "easygui.library - on the way, help needed :) (ID0_0)" From: M.Tjoelker@nl.cis.philips.com (Menno Tjoelker) Subject: Re[2]: easygui.library - on the way, help needed :) Date: Sat, 31 Oct 98 21:26:00 -0100 Jason Hulance wrote about RE: easygui.library - on the way, help needed :):= > -> Remember to handle the exception if NEW fails > h:=3DNEW [VTAG_VIEWPORTEXTRA_GET, NIL, NIL] > IF (IF cm:=3Ds.viewport.colormap THEN VideoControl(cm,h) BUT > vpe:=3Dh[1] ELSE vpe:=3DNIL) > ... > ELSE > ... > ENDIF > -> Remember to deallocate it once you're done > FastDisposeList(h) Another possibility: DEF h[3]:ARRAY OF LONG ... CopyMem([VTAG_VIEWPORTEXTRA_GET, NIL, NIL],h,12) IF ... ... The memory is freed automatically when the function is exited. It is allocated on the stack. > > Also, what does this do? (from findxy()): > > > > IF x>=3D(gad.leftedge+offx) THEN > > IF y>=3D(gad.topedge+offy) THEN > > IF gad.leftedge+gad.width>x THEN > > IF gad.topedge+gad.height>y THEN RETURN gad.userdata > > > > If this is simple bounds-checking (i.e. a point within a box), shouldn'= t > > a simpler way of expressing this be used? > > E doesn't have short-cut "AND" and "OR" so I wrote it like this to > mimic that. It's basically lots of ANDs that stop as soon as one of > them is FALSE, so you don't do any unnecessary processing. Neat, eh? > Not sure if it actually produces better or worse code than simply > using AND, though. ;-) [Ask Wouter?] The version with nested IFs produces four conditional branches. If the most= frequent case is "RETURN gad.userdata" then these branches will slow down CPUs with pipelining. Jilles Tjoelker - -- - --- Jilles Tjoelker | Craterlaan 6 | Tel. : +31.40.2427420 5632 AG Eindhoven | Fax : +31.40.2427420 (on request) The Netherlands | *** Author of Iris (mailer), Activity (activity meter), *** *** Select_Host (NapsaTerm frontend), Solitaire (WB game), *** *** Metronome (tool for musicians), etc. *** @endnode @node ID0_1 "easygui.library - on the way, help needed :) (ID0_1)" From: agraham@hal9000.net.au (Ali Graham) Date: Mon, 02 Nov 1998 08:30:51 +0930 Subject: Re: easygui.library - on the way, help needed :) On 30-Oct-98, someone (I think it was Jason Hulance) might have written: JH> Did you catch Tomasz's EasyGUI update recently? His Email address is JH> . He's done a backfill option for EasyGUI JH> windows. It works pretty well, although it might be better done using JH> the backfill hook for the window (and screen) layers. Can anyone point me in the direction of some example source that uses WA_BACKFILL? I'm sort of halfway there, but I can't really work out exactly *why* the hook is being called with the parameters it is, and how to clear the gadget imagery on a window redraw without effectively blanking out backfilled areas as well... - -- Ali Graham [ mailto:agraham@hal9000.net.au ] [ http://hal9000.net.au/~agraham/ ] . . Your mouse has moved. Windows NT must be restarted for the change to take effect. Reboot now? . [ OK ] . @endnode @node ID1_0 "UNSUBSCRIBE (ID1_0)" Date: Sun, 01 Nov 1998 18:27:57 +0000 From: gary@empire.u-net.com (Gary Colville) Subject: UNSUBSCRIBE @endnode @node ID1_1 "UNSUBSCRIBE (ID1_1)" Date: Mon, 23 Nov 1998 12:53:14 +0000 (WET) From: l21893@fc.ul.pt (Pedro Duarte) Subject: UNSUBSCRIBE Only temporary. ------------ Pedro Duarte @endnode @node ID2_0 "AMarquee (ID2_0)" From: dissident@mail.telepac.pt (Roberto) Date: Mon, 02 Nov 1998 01:22:33 +0100 Subject: AMarquee Hi! I'm translating the AMarquee protos but as it comes to these defines i'm really stuck.. Can you help me? And please explain me what the << do. Some logic operation (bit shift?)? #define QGOF_SYNC (1L<<0) #define QGOF_NOTIFY (1L<<1) #define QPRIV_KILLCLIENTS (1L<<0) #define QPRIV_ADMIN (1L<<1) #define QPRIV_GETSYSMESSAGES (1L<<2) #define QPRIV_SENDSYSMESSAGES (1L<<3) #define QPRIV_ALL ($0F) - -- rOBERTo ->dissident@mail.telepac.pt<- ICQ:14501808 @endnode @node ID2_1 "AMarquee (ID2_1)" Date: Mon, 2 Nov 1998 12:12:54 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: AMarquee On Mon, 2 Nov 1998, Roberto wrote: > Hi! I'm translating the AMarquee protos but as it comes to these defines i'm > really stuck.. Can you help me? And please explain me what the << do. Some > logic operation (bit shift?)? I'm not a C expert but this should be right (correct me if I'm wrong, though) Yes it is a logical left shift. That means that the value 1, delfined as a 32 bit number (the L) is shifted toward the left of a number of bits. In E you can use the Shl() function that is called wiht he same parameters, that is the number to be shifted (always as a 32 bit value) and the number of bits that it must be shifted. > #define QGOF_SYNC (1L<<0) > #define QGOF_NOTIFY (1L<<1) > > #define QPRIV_KILLCLIENTS (1L<<0) > #define QPRIV_ADMIN (1L<<1) > #define QPRIV_GETSYSMESSAGES (1L<<2) > #define QPRIV_SENDSYSMESSAGES (1L<<3) > #define QPRIV_ALL ($0F) So the above are: #define QGOF_SYNC Shl(1, 0) -> This is equal to 1 #define QGOF_NOTIFY Shl(1,1) -> This is 2 And so on. M&F @endnode @node ID2_2 "AMarquee (ID2_2)" From: frosetti@hotmail.com ("Dennis Andersson") Subject: Re: AMarquee Date: Mon, 02 Nov 1998 03:15:08 PST > >Hi! I'm translating the AMarquee protos but as it comes to these defines i'm >really stuck.. Can you help me? And please explain me what the << do. Some >logic operation (bit shift?)? > << is a left shift. In E you have to use Shl(x,n) to shift x n number of bits or the asm SHL. BTW does anyone know anything about the ROTL, ROTR instructions. I've seen them in an old assembler guide but none of my assemblers or E recognize it. >#define QGOF_SYNC (1L<<0) >#define QGOF_NOTIFY (1L<<1) > >#define QPRIV_KILLCLIENTS (1L<<0) >#define QPRIV_ADMIN (1L<<1) >#define QPRIV_GETSYSMESSAGES (1L<<2) >#define QPRIV_SENDSYSMESSAGES (1L<<3) >#define QPRIV_ALL ($0F) > CONST QGOF_SYNC = 1 CONST QGOF_NOTIFY = 2 CONST QPRIV_KILLCLIENTS = 1 CONST QPRIV_ADMIN = 2 CONST QPRIV_GETSYSMESSAGES = 4 CONST QPRIV_SENDSYSMESSAGES = 8 CONST QPRIV_ALL = 15 Happy coding! Dennis ______________________________________________________ Get Your Private, Free Email at http://www.hotmail.com @endnode @node ID2_3 "AMarquee (ID2_3)" Date: Mon, 2 Nov 1998 11:32:35 +0000 (UTC) From: tim@c32.keble.ox.ac.uk (Tim Bagot) Subject: Re: AMarquee On Mon, 2 Nov 1998, mauro fontana wrote: > On Mon, 2 Nov 1998, Roberto wrote: > > > Hi! I'm translating the AMarquee protos but as it comes to these defines i'm > > really stuck.. Can you help me? And please explain me what the << do. Some > > logic operation (bit shift?)? > > I'm not a C expert but this should be right (correct me if I'm wrong, > though) > Yes it is a logical left shift. That means that the value 1, delfined as a > 32 bit number (the L) is shifted toward the left of a number of bits. > > In E you can use the Shl() function that is called wiht he same > parameters, that is the number to be shifted (always as a 32 bit value) > and the number of bits that it must be shifted. > > > #define QGOF_SYNC (1L<<0) > > #define QGOF_NOTIFY (1L<<1) > > > > #define QPRIV_KILLCLIENTS (1L<<0) > > #define QPRIV_ADMIN (1L<<1) > > #define QPRIV_GETSYSMESSAGES (1L<<2) > > #define QPRIV_SENDSYSMESSAGES (1L<<3) > > #define QPRIV_ALL ($0F) > > So the above are: > > #define QGOF_SYNC Shl(1, 0) -> This is equal to 1 > #define QGOF_NOTIFY Shl(1,1) -> This is 2 > > And so on. I think Shl will be called each time one of these macros is used. You would probably be better of with SET QGOF_SYNC, QGOF_NOTIFY SET QPRIV_KILLCLIENTS, QPRIV_ADMIN, QPRIV_GETSYSMESSAGES, QPRIV_SENDSYSMESSAGES CONST QPRIV_ALL = QPRIV_KILLCLIENTS OR QPRIV_ADMIN OR QPRIV_GETSYSMESSAGES OR QPRIV_SENDSYSMESSAGES which (IMHO) is also more readable and informative. Tim Bagot @endnode @node ID2_4 "AMarquee (ID2_4)" Date: Mon, 2 Nov 1998 12:41:22 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: AMarquee On Mon, 2 Nov 1998, Dennis Andersson wrote: > << is a left shift. In E you have to use Shl(x,n) to shift x n number > of bits or the asm SHL. BTW does anyone know anything about the > ROTL, ROTR instructions. I've seen them in an old assembler guide > but none of my assemblers or E recognize it. I think the right spelling is LSR and LSR that is Logical Shift Right and Logical Shift Left. There are also ASL and ASR that is Arithmetic Shift Left and Arithmetic Shift Right that store the exiting bit to the C bit of the conditional code register (that of the carry). RORL and RORL should be ROR and ROR (or ROR.L and ROR.L) and if I remember right they rotate completely the bits towards the left or the right inserting the leaving bit at the opposite end of the elmnt (byte, word or long) that is being modified. I'm not sure if this is all right, but there should be an assembler guide on Aminet somewhere that explains all the functions of all the available Assembly instructions on the Amiga.. M&F @endnode @node ID2_5 "AMarquee (ID2_5)" Date: Mon, 2 Nov 1998 11:48:24 +0000 (UTC) From: tim@c32.keble.ox.ac.uk (Tim Bagot) Subject: Re: AMarquee On Mon, 2 Nov 1998, mauro fontana wrote: > I'm not sure if this is all right, but there should be an assembler guide > on Aminet somewhere that explains all the functions of all the available > Assembly instructions on the Amiga.. The Motorola website (*very* slow) has a PDF on the 68000. I'm afraid I can't remember the URL, and you also need to be able to do something with the PDF. However, it does give full details of all the 68000 instructions (there may be other ones for 680x0), including timings, etc. Tim Bagot @endnode @node ID2_6 "AMarquee (ID2_6)" From: norbert.roth@gmx.net (Norbert Roth) Date: Mon, 02 Nov 1998 13:42:09 +0100 Subject: Re: AMarquee Hello Tim, on 02-Nov-98 you wrote : > On Mon, 2 Nov 1998, mauro fontana wrote: > >> I'm not sure if this is all right, but there should be an >> assembler guide on Aminet somewhere that explains all the >> functions of all the available Assembly instructions on the >> Amiga.. > > The Motorola website (*very* slow) has a PDF on the 68000. I'm > afraid I can't remember the URL, and you also need to be able to > do something with the PDF. However, it does give full details of > all the 68000 instructions (there may be other ones for 680x0), > including timings, etc. Try : http://www.mot.com/SPS/HPESD/prod/0X0/680X0.html It covers the whole processor family. Regards NR - -- Remark of the day : A gleekzorp without a tornpee is like a quop without a fertsneet. (sort of) Amiga 2000 B - Blizzard 2040 40 MHz - Picasso II Gfx/Picasso96 2 MB ChipMem - 4 MB 16 bit FastMem - 96 MB 32 bit FastMem 2.7 GB SCSI HD - 12 x SCSI CD-ROM - 19" Multiscan Monitor @endnode @node ID2_7 "AMarquee (ID2_7)" From: frosetti@hotmail.com ("Dennis Andersson") Subject: Re: AMarquee Date: Mon, 02 Nov 1998 05:49:44 PST > >on 02-Nov-98 you wrote : > >> On Mon, 2 Nov 1998, mauro fontana wrote: >> >>> I'm not sure if this is all right, but there should be an >>> assembler guide on Aminet somewhere that explains all the >>> functions of all the available Assembly instructions on the >>> Amiga.. >> >> The Motorola website (*very* slow) has a PDF on the 68000. I'm >> afraid I can't remember the URL, and you also need to be able to >> do something with the PDF. However, it does give full details of >> all the 68000 instructions (there may be other ones for 680x0), >> including timings, etc. > >Try : http://www.mot.com/SPS/HPESD/prod/0X0/680X0.html > >It covers the whole processor family. > Thanks! Dennis ______________________________________________________ Get Your Private, Free Email at http://www.hotmail.com @endnode @node ID2_8 "AMarquee (ID2_8)" Date: Mon, 2 Nov 1998 15:59:02 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: AMarquee > >> The Motorola website (*very* slow) has a PDF on the 68000. I'm > >> afraid I can't remember the URL, and you also need to be able to > >> do something with the PDF. However, it does give full details of > >> all the 68000 instructions (there may be other ones for 680x0), > >> including timings, etc. > > > >Try : http://www.mot.com/SPS/HPESD/prod/0X0/680X0.html As said, I found an AmigaGuide document on Aminet containing the description of all the 68000 ASM codes and even their binary form (probably for anyone that wants to do a little of Machine Language 8) ). I was quite good and well organized. It is probably much easier to handle that a PDF file and can be used as a online help while programming. I can't remeber the exact name of the archive, but have a look on Aminet in the dev/asm directory. Another useful archive is dev/asm/68000ref.lha that contains a list of all available ASM commands and lots of useful information in two pages that may be used for quick reference. M&F @endnode @node ID2_9 "AMarquee (ID2_9)" Date: Mon, 2 Nov 1998 16:04:22 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: AMarquee > I think Shl will be called each time one of these macros is used. You > would probably be better of with > > SET QGOF_SYNC, QGOF_NOTIFY [..] Yes, that right. But I wanted to translate the C macros exactly. Yet, those CONSTant should have the option to be defined by other ways other than directly by a number... but this is another thing to add to the AmigaE to do list. M&F @endnode @node ID2_10 "AMarquee (ID2_10)" Date: Mon, 02 Nov 1998 11:28:39 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: AMarquee Roberto wrote: > > Hi! I'm translating the AMarquee protos but as it comes to these defines i'm What is AMarquee? - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID2_11 "AMarquee (ID2_11)" Date: Wed, 04 Nov 1998 14:14:46 +0100 From: gamboni@fastnet.ch (Maxime Gamboni) Subject: Re: AMarquee mauro fontana wrote: > As said, I found an AmigaGuide document on Aminet containing the > description of all the 68000 ASM codes and even their binary form > (probably for anyone that wants to do a little of Machine Language 8) ). > I was quite good and well organized. It is probably much easier to handle > that a PDF file and can be used as a online help while programming. I > can't remeber the exact name of the archive, but have a look on Aminet in > the dev/asm directory. > > M&F Such an archive would interest me, but I did not find it in dev/asm. :-( Maxime @endnode @node ID2_12 "AMarquee (ID2_12)" From: norbert.roth@gmx.net (Norbert Roth) Date: Wed, 04 Nov 1998 14:48:26 +0100 Subject: Re: AMarquee Hello Maxime, on 04-Nov-98 you wrote : > mauro fontana wrote: > >> As said, I found an AmigaGuide document on Aminet containing >> the description of all the 68000 ASM codes and even their >> binary form (probably for anyone that wants to do a little of >> Machine Language 8) ). I was quite good and well organized. It >> is probably much easier to handle that a PDF file and can be >> used as a online help while programming. I can't remeber the >> exact name of the archive, but have a look on Aminet in the >> dev/asm directory. >> > >> M&F > > Such an archive would interest me, but I did not find it in > dev/asm. :-( Have you tried : dev/asm/MC680x0.guide ? Regards NR - -- Remark of the day : Genius is the talent of the man who is dead. Amiga 2000 B - Blizzard 2040 40 MHz - Picasso II Gfx/Picasso96 2 MB ChipMem - 4 MB 16 bit FastMem - 96 MB 32 bit FastMem 2.7 GB SCSI HD - 12 x SCSI CD-ROM - 19" Multiscan Monitor @endnode @node ID2_13 "AMarquee (ID2_13)" Date: Thu, 05 Nov 1998 17:01:03 +0100 From: gamboni@fastnet.ch (Maxime Gamboni) Subject: Re: AMarquee Norbert Roth wrote: > > Such an archive would interest me, but I did not find it in > > dev/asm. :-( > > Have you tried : dev/asm/MC680x0.guide ? Thanks, I will have a look at it. :-) Maxime @endnode @node ID2_14 "AMarquee (ID2_14)" Date: Thu, 05 Nov 1998 13:18:38 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: AMarquee Maxime Gamboni wrote: > > Norbert Roth wrote: > > > > Such an archive would interest me, but I did not find it in > > > dev/asm. :-( > > > > Have you tried : dev/asm/MC680x0.guide ? > > Thanks, I will have a look at it. :-) > > Maxime No One STILL told me what AMarquee is... - -MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID2_15 "AMarquee (ID2_15)" From: dissident@mail.telepac.pt (Roberto) Date: Thu, 05 Nov 1998 22:22:06 +0100 Subject: Re: AMarquee Hi Tim! On 02-Nov-98, you wrote: > I think Shl will be called each time one of these macros is used. You > would probably be better of with > > SET QGOF_SYNC, QGOF_NOTIFY > > SET QPRIV_KILLCLIENTS, > QPRIV_ADMIN, > QPRIV_GETSYSMESSAGES, > QPRIV_SENDSYSMESSAGES > > CONST QPRIV_ALL = QPRIV_KILLCLIENTS OR > QPRIV_ADMIN OR > QPRIV_GETSYSMESSAGES OR > QPRIV_SENDSYSMESSAGES > > which (IMHO) is also more readable and informative. You're right. Thank you and all the other guys that replied! - -- rOBERTo ->dissident@mail.telepac.pt<- ICQ:14501808 @endnode @node ID2_16 "AMarquee (ID2_16)" From: dissident@mail.telepac.pt (Roberto) Date: Thu, 05 Nov 1998 22:21:06 +0100 Subject: Re: AMarquee Hi Maxim! On 02-Nov-98, you wrote: >> Hi! I'm translating the AMarquee protos but as it comes to these defines >> i'm > > > What is AMarquee? From AMarquee's documentation: "AMarquee is a mechanism by which Amiga programs and ARexx scripts on multiple Amigas may easily communicate data to each other in a many-to-many, "broadcast" fashion. It consists of two parts, an inetd daemon for the server computer to run, and a shared library for client computers to run." It's on Aminet, check it out! - -- rOBERTo ->dissident@mail.telepac.pt<- ICQ:14501808 @endnode @node ID3_0 "RemoveGList problems (ID3_0)" Date: Mon, 2 Nov 1998 12:43:41 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: RemoveGList problems I am trying to add an iconification option to my program BAH. For iconification I mean that the window is reduced at the smallest dimensions (that of the titlebar). I just would like some opinions on which is the best way to obtain it. At this point I have tried two ways with a variation on the last: 1) Close completely the old window and open a new one of the desired size. But this is not efficient at all as I have to remove menus for the older window and then restore them before reopening it again. And this mode needs opening/closing two windows for both the actions (iconify/display). 2) Just resize the size of the window (keeping the old size saved). This seems to be the better solution but a question remain: it i safe to resize a window to the dimensions of the titlebar leaving all the other gadgets I have in the window still linked to it? They are there even though they are out of the window dimensions. Can this a cause of problems? I have tried to remove the gadget list from the window with the RemoveGList and then to restore them with the AddGList functions but I have quite ome problems. I, of course, have a pointer to the first of the gadgets in the list that I have created and that is passed to the window when it opens. Trying to remove the gadgets, however (through a RemoveGList(window, firstgadget, -1) where -1 means all the gadgets in the list) results in te removal of the system gadgets as well (the depthgadget the dragbar and the closegadget). Restoring the gadgetlist reattach even the system gadgets. I have tried also to remove the right number of gadgets from the window (substituting the -1 with a number) but when adding the gadget list again the program crashes. Hany help appreciated. Thanks in advance. M&F @endnode @node ID4_0 "EasyGUI/E problem, or something larger? (ID4_0)" Date: 03 Nov 98 02:56:11 -0500 From: victord@netrover.com ("Victor Ducedre") Subject: Re: EasyGUI/E problem, or something larger? Quoting Ali Graham... >> I've actually simplified the GUI definition to *one* element, and >> The Problem still lives... (sigh) >ow. :( How about the various options passed to guiinitA()? Is any of >those causing it? Are you using any PLUGINs that haven't been >recompiled against other sources that have changed? (this could >probably throw things off even if they weren't actually used by the >program, as EC would get its offsets in a twist while compiling...) There are no plugins, and changing the options does nothing. Just to see, I put the main window and the problem window into their own guitest program, with no other functions, and both windows take some some time to fully draw, and slow the pointer considerably while doing so. I've even tried recompiling EasyGUI, and strangely, the (unedited) source EasyGUI.e compiles 1100 bytes larger than the module included in the v3.3 archive. [...] >Also, have you tried to EDBG the offending parts - including the >EasyGUI source? Trace through that as well, as part of the debugging, >and you may find something interesting happening... (and have Enforcer >& Sushi, and maybe Mungwall, running at the same time...) This part is >a lot of work, but indispensable if nothing else works... This spawns a whole new set of questions/problems. 1) I recompiled my guitest program and EasyGUI.e with the DEBUG option and ran it through EDBG. Now let me interrupt here by mentioning that I'm not exactly sure what to do with EDBG, I mean, I can follow along with the program while it's running to see what it's doing, but I don't know what information to look for, or what it is specifically I'm looking at, or what to do about it if it doesn't look right. That said, the test program works just fine when run from EDBG, without any delays at all. If I run it by itself, of course, it still crawls. (?) 2) In the full program, a second task is run from the first, and has a number of Forbid()s/Permit()s in place. Will this play havoc with EDBG? 3) And generally, given my inability to grasp the concept of EDBG :-) what is the standard/preferred combination of programs, such as you've mentioned above, recommended for all-purpose programming use. When do I run them, and in what order?!? Can't they just make something that will digest my programs and spit out something that works?!?!!? Ok, better now. Any further suggestions, help, etc. welcomed. >... or a race condition which pops up only on a faster processor. I'm >a software guy, in general, and I like to explore absoultely everything >before I start blaming the hardware :) I'm not even sure where to begin on the subject of "race conditions". - -- Victor Ducedre (victord@netrover.com) Team AMIGA Now proud keeper of the XPKatana spell (v 1.4 on its way). "You spelled 'ballon' and 'vodoo' wrong," Tom said morosely. @endnode @node ID4_1 "EasyGUI/E problem, or something larger? (ID4_1)" From: a9660319@wlv.ac.uk Subject: Re: EasyGUI/E problem, or something larger? Date: Tue, 3 Nov 1998 11:51:30 -0500 (EST) > 3) And generally, given my inability to grasp the concept of EDBG > :-) what is the standard/preferred combination of programs, such as > you've mentioned above, recommended for all-purpose programming use. > When do I run them, and in what order?!? Can't they just make something > that will digest my programs and spit out something that works?!?!!? Try enforcer and mungwall. (You are using enforcer right :) The idea behind EDBG is so that you can see what your vars. contain as you go along, so you can check to see if vars get loaded with silly values, or perhaps the program goes around a loop too many times, EDBG will show you this. > >... or a race condition which pops up only on a faster processor. I'm > >a software guy, in general, and I like to explore absoultely everything > >before I start blaming the hardware :) Um... What *are* "race conditions". Thanks. Andrew Hutchins. @endnode @node ID5_0 "Audio questions (ID5_0)" Date: Tue, 03 Nov 1998 08:23:23 +0100 From: Rainer.M.Mueller@uni-konstanz.de (Rainer =?iso-8859-1?Q?M=FCller?=) Subject: Re: Audio questions - --=====================_910074203==_ Content-Type: text/plain; charset="us-ascii" Hi ! >As far as I'm getting into the creation of a new tool for musicians, I'd be >glad if someone of you could send me material on > >1) using audio.device (channel allocation, sample playing, ...) attached to the mail is a little prog using audio.device. I wrote it some years ago in order to learn the usage of audio.device. It used to work (I can't test it on my PC using UAE because the sound emulation doesn't work) >2) making Fast Fourier Transform (FFT) and DFT If someone knows something about FFT, please let me know, too ! Rainer - --=====================_910074203==_ Content-Type: application/mac-binhex40; name="playsamp.e" Content-Disposition: attachment; filename="playsamp.e" Part 1.2Type: Macintosh BinHex Archive (application/mac-binhex40) 0#5!JC'&dB@aPEMSp4QPXC8aPEQGdD#KKFQFT$5!J)#!J)%P')#KNBA4KF(4b1Me "E'a[BeCPBb!J+'4KG'&XC@iX)#"048e'Ad0)59!V68904Pp398*-58-T+5!p6NP - -)#!J)#"85%91)&*KDA0P+%95Adj26890+3dJ)#!J)#"*4JNJ)#"5C@&N)#!J)#! J+'CTE'9`G()X)'4KG'&`G()X)#"NBA4KE'9Z+5!J)#!J)$`qC'&dB@aPEL"85%9 1)&*KDA0P+%95Adj26%p"4#N0$5mU+LSU+LSU+JP6B@e`E'8JB@*cF'PPE'9Z#5S U+LSU+LSU,`d0#3P`E'&j8f&YF'aP+$!X)'4KG'&XC@iT$3d[+LSU+LSU+LS*8f& YF'aP)'&LFh"TC@aPEJNU+LSU+LSU+Lm0)#!J48j%58B0$89B3d939#"%6`dJ)#" *4L"NBA4KF(4b)&4)48iJ4R*PC9CPBbKNBA4KF(4b+3dJ)#"*4L"QD@aPF(4b)&4 )48iJ3fa[Ff8J)#KQD@aPF(4b+3dJ)#"648a&3e3JCAKMCA"dD@pZ$5!J)#!J)%0 "8d8J49*I6Np28%91)#!l)&"bD@jd4LJRDfpZER4P)%4KG'9T)'jTBfKd)2CQCQj PEPaZ*bN0)#!J)#!J3d&645"&8Pp16de&65!J)$XJ8(*TER4'+#GVC@PZ)&0`C@P MD'9bA'iR+3dJ)#!J)#"$390&)%95Adj26N8J)#!J1b"3FQPZG%BS*f&XE'9c)%p ,A'iR+3dJ)#"&6N4648a&3e3048j%8&*23`d0$3d08&*23b"`E'&j8f&YF'aP+(C [ELaKERST)%K"6N4-43e%48BJBA*PFA9PFh3a1P"88L"86b"TEf&eC'P[,!dJ)#! JBA*PFA9PFh3b1QP[BA9ND@mX$5!J)#"bCA"XH6%p6NP-1P"88L"86b"YF#`0)#! J)(*PF'aj-Me158`k8&45)&42)'e`,!dJ)#!JD@pK1P"88L"86b"TEf&eC'P[,!d J)#!JE@j[C'8k8&45)&42)'eZ,!dJ)#!JBfKTF'*eCM%p6NP-1P"88L"86b"$5%& 5,!dJ)#!JBfKTF'*eCM)p6NP-1P"88L"86b"$5%&5,!dJ)#!JCfmp-#`0)#!J)'4 PGQPMC@9bFQpb26%X$5!J)#"[CQCcCA3X$5!J)#"dD@ePFb`0)#!J)(*PFh30$5! J)%P')#JJ)#"bCA"XH6%k280bC@&dC8ecCe"[FR3S+5!J)#!J)#!J)#!J)#!J)#! J)#!J)#!J)#Np6NP-)&4)48iJ8Q&TFf8S49*I6Np36e*8+3dJ)#"*4L!S)#!JFQ9 `E(Nb1Me$FQ9KG'90FfG3Eh*d+#NJ)#!J)#!J)#!J)#!J)#!J)#!J)#!J)#!T28j *6#"85%91)&*KDA0P+%95Adj28%p59#N0)#!J58BJ+'&bCA&eCA0d-6Sp3h*PBA4 P58p5CA&eCA0d+(*PF'aj-5`J8dPD48p')'P[BA9ND@mT+6e158`J9%K&6L"5B@P cC5K&8Pp16dP28N94+3d0)#!J,bSJGf&ZG#"dEb"KE'a[Bf&dC5"KEQ3JGA0P)'& ZH5"MD'&ZEQ9X)(GTG'JJ6h"PEN4PGLJT)#S[$5!J)'&bCA&eCA0d-5jTEbjYELj XELj`FQNk28&%38a-6d0I68&B8&*&3`dJ)#"KFQ9aG@9cG$%ZD@mZBfpYE@&ZC#! J1Me"4%004&p"6%a23d&843dJ)#"KFQ9aG@9cG$%ZD@mZCQaKCh-*)$Sp384*6dC I6NpA38P8$5!J)'&bCA&eCA0d-5jKE'a[BfYPH3NJ1Md`$5!J)'&bCA&eCA0d-5j NBA4K#5!k29Xa,$)X0#`iA6T$5%&5$5!J)'&bCA&eCA0d-5jXC@jRG'J*)$Sp0$X 0)#!J58BJC'9fD@0PCA*bEh)k28p`C@j%CACTBf8S*f&eC'P[,Q4PGQPMC5FX)$! X)'&bCA&eCA0d-5`J-#NJ9%K&6L"5B@PcC5K&8Pp16d4&9NP$45N0$5!J)#mU)'0 [F(NJD@pbCA&eCA0d)'C[FL"NEh9LE'8JBR9QCQ9bC@3JEh"PFQ&dD@pZ)#S[$5! J)'&bCA&eCA0d-5jTEbjMEfeYB@jN1Me$684I9e**9%80)#!JBA*PFA9PFh3a,QP [,QCXB@Gc)#!k28&%58p'Ae"&8PC26!dJ)#"KFQ9aG@9cG$%ZF'9bD@pN)#!J)$S p4'Pf+'0XEf0V,#"cB@ebBA4P+3dJ)#"KFQ9aG@9cG$%ZGQpXG@eP)#!J)$SpGQp XG@eP$5!J)'&bCA&eCA0d-5jMH@0XCA-J)#!J1Mda$5!J)%0[F(P0C@dSBA*PFA9 PFh3a,'&bCA&eCA0d-L`J8dPD48p')'P[BA9ND@mT$3d0)#!J58BJC'&dB@aPEL! q25!a0M-i0!dJ)#!J)#"*4L!SBfKTF'*eCM%k28&XE'pM9Q9M+$Ja16)X)%e&68C I3dK*8#Y048e'Ae"93Na*3bNT28j*6#"85%91)&*KDA0P+%95Adj26890+3dJ)#! J)#"*4L!SBfKTF'*eCM)k28&XE'pM9Q9M+$Ja16)X)%e&68CI3dK*8#Y048e'Ae" 93Na*3bNT28j*6#"85%91)&*KDA0P+%95Adj26890+3d0)#!J)#!JG'PYCA-k23N J4'Pf+'&ZHL`J)#!i-6Nb+3dJ)#!J)#!JFQ9cG$SpB@jk,8eeE#KdD@ePFb`J1$% j-LN0)#!J)#!JG'PYCA-k2A4TE@9c)#dJ-Jd0)#!J)#!JE@j[C'8*)#!J)#!k2@& bCA&eCA0d-JdJ)#!J)#"YEQpNC5jbCA"XHA"[FR3k2A*PF'aj-Jd0)#!J)#!J,bS JFf9ZC#"QDA*cG#"dGfmJBR9QCQ9b*h-JCR9XE#"dEb"NCACTBf8J+Lm0)#!J)#! J3fp`H8ePE5KNBA4KF(4b+hC[EL`JBfKTF'*eCM%X)$Ja16)T$5!J)#!J)'pQCR0 PG$Sp1$%j-JdJ)#!J)#"KFQ9aG@9cG$%ZC'&dB5!J1MeMD'P`BR9Q-3dJ)#!J)#" KFQ9aG@9cG$%ZE'9ZCh4S1Mdi-6Nb$5!J)#!J)'*PCfPZ58mSBA*PFA9PFh3a+3d J)#!J)#"$Eh"j6@9Y+'4KG'&`G()VGQpZ+fpQCR0PG#`JBfKTF'*eCM)X)$Ja16) T$5!J)#!J)'pQCR0PG$SpEfCQFf9d)#XJ1$%j-JdJ)#!J)#"KFQ9aG@9cG$)ZC'& dB5!J1MeMD'P`BR9Q-JdJ)#!J)#"KFQ9aG@9cG$)ZE'9ZCh4S1Mdi-6Nb$5!J)#! J)'*PCfPZ58mSBA*PFA9PFh3b+3d0)#!J)#!JE@j[C'8k2@&bCA&eCA0d-3N*#5m U)(GKDA3JEfiJFQ9aG@9cG$%JCQPbFh3JG'PYC5"KFQpeEQ3J+Lm0)#!J)#!J8N9 348&8#3N*#5mU)(9ZG'PX)'4[EQ8X)'YPCA!JCQ9PC'PZCb"NBA4K)(4[)'4PGQP MC5!U,`d*)&GKDA43Eh*d+'eZEf4P,R*PF'ajF'pbG#N0#5"(CA40FfFJ)#KYEQp NC5jbCA"XHA"[FR3T$3NJD@pK1MeYEQpNC3d*)%P')'P[B6eKFQ9aG@9cG$%0#5! J)#"YEQpNC6SpBA*PFA9PFh3b$3NJ48a643d*)#!J)'eZEf4P1MeKFQ9aG@9cG$% 0#5"&6N4*4Jd*)%P')(4TE@9c2$i`$9GbDA4P4LJRA'3J)&aN)#!J)&aNA'iR,'0 SDA"LG@Ba,'0SDA"LG@Bb,'P[B5jNBA4K+3d*)#!J)%0[F(P0C@dSC'&dBA"dFLY fEfiVEfCQFf9d,#"TEf%ZC'&dB5`J1$%j-LN0#5!J)#"TEf%ZE'9ZCh4S1Mdi-6N b$3NJ)#!JBQ9RD@j*6bKTEf%T$3NJ)#!JEfCQFf9d1Me[CQCcCA3V1$%j-Jd*)#! J)%4&3b"dD@ePF`d*)%9-8d9*4L!SG'PYCA-p-#NJ38j%)#KbCA0d2$i`+3eAFQP dC8BS*eaN)#"FC#!J)#"FC&aZ*baMD'P`BR9Q-5aMD'P`BR9Q-LaTEf%ZC'&dB5N 0#5!J)#"$Eh"j6@9Y+'4KG'&`G()VGQpZ+fpQCR0PG#`JD@pK,Q4KG'%X)(*PFh3 T$3NJ)#!JD@pK,QaPEQGdD$SpFQ9cG!d*)#!J)'*PCfPZ58mSD@pK+3d*)#!J)(* PFh3k26!0#5"&6&0&$3NJ)#!JCfmk26%0#5!J)#"AB@Pd8'pbG#KYEQpNC5jbCA" XHA"[FR3T$3NJ)#!J4f9d6A0R)#!SE@j[C'8ZFQ9`E(P`Eh*d+3d*)%914%P'$5! J)#!J)&919%P-)'G[26%0$5!J)%9-8d80)#!J)#!J58BJ+'0SDA"LG@Ba1Me"E'a [BeCPBbKKERSX)%e&68CI3dK*8#Y048e'Ae"93Na*3bNT28j*6#"85%91)&*KDA0 P+%95Adj26890+3d0)#!J)#!JE@j[C'8*)#!J)#!k2@&bCA&eCA0d-3dJ)#!J)#" YEQpNC5jbCA"XHA"[FR3k2A*PF'aj-3d0)#!J)#!J3fp`H8ePE5KNBA4KF(4b+hC [EL`JBfKTF'*eCM%X)'&ZHLN0)#!J)#!JBA*PFA9PFh3a,Q4KG'%J)$SpBfKTF'* eCM%0)#!J)#!JBA*PFA9PFh3a,QaPEQGdD$SpB@jk$5!J)#!J)'*PCfPZ58mSBA* PFA9PFh3a+3dJ)#!J)#"AB@Pd8'pbG#KYEQpNC5jbCA"XHA"[FR3T$5!J)#!J)%G PG%ecCb!J+'eZEf4P,R*PF'ajF'pbG#N0)#!J48j%58B0$3e&@%0&8&3J4%m0)#! J58BJBfKTF'*eCM)*)#!J)&4)48iJ4R*PC9CPB`NSBfKTF'*eCM)T$5!J)%P')'0 SDA"LG@Ba#5!J)#"85%91)%CbC@9@C@-*+'0SDA"LG@Ba+3dJ)#"*4L"NCACTBf9 PFR*[FMd`)&4)48iJ3fa[Ff9%CACTBf8*+'&bCA&eCA0d-5N0)#!J58BJBA*PFA9 PFh3a)#!J)#"85%91)%4PE'9dC8P28Q9aG@9cG#KKFQ9aG@9cG$%T$5!J)%P')(* PF'aj-JNJ)#!J9%K&6L"%C@aPG'90FfG3Eh*d#5KbCA"XH6)T$5!J)%P')(*PF'a j-3NJ)#!J9%K&6L"%C@aPG'90FfG3Eh*d#5KbCA"XH6%T$5!J)&0&6%9$9#"PH'0 PF(4TEfi0)#!J)#!J3d&645"&8Pp16de&65!J)$XJ8(*TER4'+#GVC@PZ)&0`C@P MD'9bA'iR+3dJ)#!J)#"$390&)%95Adj28%p59#!J1b"3FQPZG%BS*fY[EQjdC5" 3Eh*d)'jTBfKd)'9bHQ9eCf9ZA'iR+3dJ)#!J)#"$390&)%95Adj258p549%J1b" 3FQPZG%BS*fY[EQjdC5"*6e*PFA9PFh3JEQPMD(3JCA*kCA9RC@jFELFT$5!J)#! J)%0"8d8J49*I6Np%49C*3d8l)&"bD@jd4LJRDfpZER4P)%&eC'P[,84PGQPMC5" ZD@0SG#$fCQCZC@jFELFT$5!J)#!J)%0"8d8J49*I6Np145!J)#!l)&"bD@jd4LJ RB@aXCA-J6dYFELFT$5!J)%914&0&6%9$9!e&6N438Np$$3d0VL!!!!: - --=====================_910074203==_ Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable ============================================================ // Rainer M|ller A1200-030-50MHz 16MB/850MB // Pentium 166MHz 32MB/2.1GB // have a look at: Aminet:mus/edit/SampleE \\ // \X/ AMIGA for ever ! - --=====================_910074203==_-- @endnode @node ID5_1 "Audio questions (ID5_1)" From: sanric@ronet.it (Riccardo Santato) Date: Sat, 07 Nov 1998 11:28:29 +0100 Subject: Re[2]: Audio questions Warning: This is a message in MIME format. Your mail reader does not support MIME. Some parts of this message will be readable as plain text. To see the rest, you will need to upgrade your mail reader. - --BOUNDARY.2016174376.1 Content-Type: text/plain Hello Rainer I've decoded and compiled your source. Fine, everything went ok,without any warnings, but when I try to use it with an argument it always tells me that "konte Datei nicht often !" (or something similar) which I think it stands for "CAN'T OPEN FILE". I've tried either with raw or 8svx samples but nothing to do. My machine has 32 MgBytes of Ram and I'm sure the file exists. What can I do ? Here's attached the decoded source. - -- ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== - --BOUNDARY.2016174376.1 Content-Type: text/plain; charset=iso-8859-1; name="suoni_norm.e" Content-Disposition: attachment; filename="suoni_norm.e" Content-Transfer-Encoding: quoted-printable MODULE 'amigalib/io', 'devices/audio', 'dos/dos', 'exec/io', = 'exec/memory', 'exec/nodes', 'exec/ports', 'graphics/gfxbase' ENUM ER_NONE, ER_NOOPEN, ER_NOMEM, ER_NOPORT, ER_NOIOREQ, ER_NODEVICE, ER= _NOLOAD CONST NTSC_CLOCK=3D3579545, PAL_CLOCK=3D3546895 DEF clock DEF samrate=3D17000 DEF volume=3D64 DEF fileptr=3DNIL DEF dataptr=3DNIL:PTR TO CHAR DEF datalen=3DNIL PROC main() HANDLE DEF gfx:PTR TO gfxbase gfx:=3Dgfxbase IF gfx.displayflags AND PAL THEN clock:=3DPAL_CLOCK ELSE clock:=3DNTSC= _CLOCK IF arg[]<>0 IF (fileptr:=3DOpen(arg, MODE_OLDFILE)) =3DNIL THEN Raise(ER_NOOPE= N) datalen:=3DFileLength(arg) IF (dataptr:=3DAllocVec(datalen,MEMF_CHIP+MEMF_PUBLIC))=3DNIL THEN = Raise(ER_NOMEM) IF Read(fileptr, dataptr, datalen)<>datalen THEN Raise(ER_NOLOAD) /******** Sample abspielen ********/ playSample(0, datalen) /******** Sample abspielen ********/ ENDIF EXCEPT DO IF dataptr THEN FreeVec(dataptr) IF fileptr THEN Close (fileptr) SELECT exception CASE ER_NOOPEN ; PrintF('Non riesco ad aprire il file\n') CASE ER_NOMEM ; PrintF('kein Speicher\n') CASE ER_NONE ; PrintF('alles OK\n') ENDSELECT ENDPROC PROC playSample(von,anz) HANDLE DEF arequest1:PTR TO ioaudio, arequest2:ioaudio, reply1=3DNIL:PTR TO mp, reply2=3DNIL:PTR TO mp, ioa:PTR TO ioaudio, mnode:PTR TO mn, chipbuf1=3DNIL:PTR TO CHAR, chipbuf2=3DNIL:PTR TO CHAR, go=3D0, deviceerror=3D1, offset, times, rest IF ( reply1:=3DCreateMsgPort())=3DNIL THEN Raise(ER_NOPORT) IF ( reply2:=3DCreateMsgPort())=3DNIL THEN Raise(ER_NOPORT) IF (arequest1:=3DCreateIORequest(reply1, SIZEOF ioaudio))=3DNIL THEN R= aise(ER_NOIOREQ) /* want to allocate and use any channel with OpenDev() */ arequest1.io.mn.ln.pri:=3DADALLOC_MAXPREC arequest1.io.command :=3DADCMD_ALLOCATE arequest1.io.flags :=3DADIOF_NOWAIT arequest1.allockey :=3D0 arequest1.data :=3D[1,2,4,8]:CHAR arequest1.length :=3D4; IF deviceerror:=3DOpenDevice('audio.device', 0, arequest1, 0) THEN Rai= se(ER_NODEVICE) /* copy iorequest for double buffered operation */ arequest1.io.command:=3DCMD_WRITE arequest1.io.flags :=3DADIOF_PERVOL arequest1.period :=3DDiv(clock, samrate) arequest1.volume :=3Dvolume arequest1.cycles :=3D1 CopyMem(arequest1,arequest2, SIZEOF ioaudio) IF datalen >=3D 16384 IF (chipbuf1:=3DAllocVec(8192, MEMF_CHIP+MEMF_PUBLIC))=3DNIL THEN R= aise(ER_NOMEM) IF (chipbuf2:=3DAllocVec(8192, MEMF_CHIP+MEMF_PUBLIC))=3DNIL THEN R= aise(ER_NOMEM) times:=3D Div(anz, 8192) rest:=3Danz-Mul(times, 8192) times:=3Dtimes - 2 mnode :=3Darequest2 mnode.replyport:=3Dreply2 /* send first two buffer's full to device */ CopyMem(dataptr+von, chipbuf1, 8192) offset:=3D8192 arequest1.data :=3Dchipbuf1 arequest1.length:=3D8192 beginIO(arequest1) CopyMem(dataptr+von+offset, chipbuf2, 8192) offset:=3Doffset + 8192 arequest2.data :=3Dchipbuf2 arequest2.length:=3D8192 beginIO(arequest2) mnode:=3Darequest1 /* wait on request1 first time around */ REPEAT /* until done, keep feeding data to device */ WaitPort(mnode.replyport) GetMsg (mnode.replyport) ioa:=3Dmnode IF ioa=3Darequest1 mnode:=3Darequest2 ELSE mnode:=3Darequest1 ENDIF IF times<>0 WriteF('\d \d \d\n',chipbuf1,chipbuf2,ioa.data) CopyMem(dataptr+von+offset, ioa.data, 8192) ioa.length:=3D8192 beginIO(ioa) offset:=3Doffset+8192 DEC times ELSEIF (times=3D0) AND (rest<>0) WriteF('\d \d \d\n',chipbuf1,chipbuf2,ioa.data) CopyMem(dataptr+von+offset, ioa.data, rest) ioa.length:=3Drest beginIO(ioa) rest:=3D0 ELSE go:=3D1 WaitPort(mnode.replyport) GetMsg (mnode.replyport) ENDIF UNTIL go=3D1 ELSE IF (chipbuf1:=3DAllocVec(anz, MEMF_CHIP+MEMF_PUBLIC))=3DNIL THEN Ra= ise(ER_NOMEM) mnode :=3Darequest1 mnode.replyport:=3Dreply1 CopyMem(dataptr+von, chipbuf1, anz) arequest1.data :=3Dchipbuf1 arequest1.length:=3Danz beginIO(arequest1) WaitPort(mnode.replyport) GetMsg (mnode.replyport) ENDIF EXCEPT DO IF chipbuf2 THEN FreeVec (chipbuf2) IF chipbuf1 THEN FreeVec (chipbuf1) IF deviceerror=3D0 THEN CloseDevice (arequest1) IF arequest1 THEN DeleteIORequest(arequest1) IF reply2 THEN DeleteMsgPort (reply2) IF reply1 THEN DeleteMsgPort (reply1) SELECT exception CASE ER_NOMEM ; PrintF('kein Speicher\n') CASE ER_NOPORT ; PrintF('konnte Port nicht erzeugen\n') CASE ER_NOIOREQ ; PrintF('konnte IORequest nicht erzeugen\n') CASE ER_NODEVICE; PrintF('konnte Audio-Device nicht =F6ffnen\n') CASE ER_NONE ; PrintF('alles OK\n') ENDSELECT ENDPROC - --BOUNDARY.2016174376.1-- @endnode @node ID5_2 "Audio questions (ID5_2)" Date: Mon, 9 Nov 1998 12:21:56 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Re[2]: Audio questions I had a quick look at the code and I have seen that Open() function use arg as its parameter for the name. If I can remeber right rg is a pointer to an array of pointers that, in turn, points to the data that are passed as arguments. So you ought to use args[0] as the name of the filenor arg. A better solution would be to provide the pogram with an argument parser witht he use of the ReadArgs() function so that more parameters with a user readable template coul be used. M&F @endnode @node ID5_3 "Audio questions (ID5_3)" Date: Mon, 9 Nov 1998 13:10:26 +0100 (MET) From: subvcbhd@calvados.zrz.TU-Berlin.DE (Henk Jonas) Subject: Re: Re[2]: Audio questions On Mon, 9 Nov 1998, mauro fontana wrote: > I had a quick look at the code and I have seen that Open() function use > arg as its parameter for the name. If I can remeber right rg is a pointer > to an array of pointers that, in turn, points to the data that are passed > as arguments. So you ought to use args[0] as the name of the filenor arg. >=20 > A better solution would be to provide the pogram with an argument parser > witht he use of the ReadArgs() function so that more parameters with a > user readable template coul be used. There is also a problem with spaces after the filename, if you use arg[0]. You get then to Open() a string just like "df0:blafile.bla ", if you use ReadArgs() it will be the right "df0:blafile.bla" without spaces added on the end of the string. This occures mostly if you use a CON: with filename completing(?) like VNCED or KCON Henk - ---------------------------------------------------------------- Henk Jonas | subvcbhd@linux.zrz.tu-berlin.de Student der | Energietechnik | http://www.cs.tu-berlin.de/~jonash > Ich lehne Atomenergie als Energiealternative ab! niX=B3 Castor < - ---------------------------------------------------------------- * AmigaMetaFileFormat * MetaView * Messlabor * Voxelflight * - ---------------------------------------------------------------- Fuer die 'Mitleser': ANARCHIEBNDAKWPKKRAFRADIKALTNTKPDPDSREVOLUT @endnode @node ID5_4 "Audio questions (ID5_4)" Date: Tue, 10 Nov 1998 07:22:43 +0100 From: Rainer.M.Mueller@uni-konstanz.de (Rainer =?iso-8859-1?Q?M=FCller?=) Subject: Re: Re[2]: Audio questions - --=====================_910675363==_ Content-Type: text/plain; charset="us-ascii" Hi ! >Fine, everything went ok,without any warnings, but when I try to use it with >an argument it always tells me that "konte Datei nicht often !" (or something >similar) which I think it stands for "CAN'T OPEN FILE". Oh no, sorry, this was quite stupid by me not to translate the errormessages. Attached is the source with english messages ! >I've tried either with raw or 8svx samples but nothing to do. This doesn't matter as this is a very primitive example, that plays everything you put. >I'm sure the file exists. may be, but was the path correct ?? >What can I do ? I managed to get the UAE sound emulation get working and the example worked. As I mentioned above, are you sure the path to your file you pass as argument was correct ?? If not try with the correct path (if you have, use snoopdos !) If it doesn't help: try this (that way I tested the program some hours ago) open a shell window, change dir to "ram:", copy "suomi_norm.e" to "ram:", compile the source "ec suomi_norm", start the prog with "suomi_norm suomi_norm.e". That worked on my machine !! Greetings, Rainer - --=====================_910675363==_ Content-Type: application/mac-binhex40; name="suoni_norm.e" Content-Disposition: attachment; filename="suoni_norm.e" Part 1.4Type: Macintosh BinHex Archive (application/mac-binhex40) bCbN0)#!J)#!J58BJ+'4KG'&`G()k28&XE'pM9Q9M+'4KG'&XC@iX68904Pp$5%P 3+de&68CI8&9#6%P$+5Np6NP-)&4)48iJ8Q&TFf8S49*I6Np048dT$5!J)#!J)%P '#9*PB@3SCQPXCA"dFL`JC'&dBA"dFL`J)'4KG'&XC@iT2$jNBA4KE'9Z)&4)48i J8Q&TFf8S49*I6Np-6d&%+3d0,bSU+LSU+LSU#A*PF'aKH5"cB@e`E'8*)#!J)#! J+LSU+LSU+LS[$3N*F'aKH90KEA"XC5J`,#"NBA4KE'9Z+3d0,bSU+LSU+LSU#A* PF'aKH5"cB@e`E'8*)#!J)#!J+LSU+LSU+LS[$5!J)%914%P'$3e&@%0&8&3J4%m 0)#!J58BJC'&dBA"dFL"85%91)%CbC@9@C@-SC'&dBA"dFLN0)#!J58BJCQPXCA" dFL"85%91)%0XEh0P)#!SCQPXCA"dFLN0)#!J8d9-4808)'9iBf9`G'P[EJdJ)#! J)#"$390&)%95Adj26e"&6L!J1b"3FQPZG%BS*f0[G@aN)'j[G#"[F'9Z)'CTE'9 FELFT$5!J)#!J)%0"8d8J49*I6Np048dJ)#!l)&"bD@jd4LJREQmJE@9YEh*jA'i R+3dJ)#!J)#"$390&)%95Adj26N8J)#!J1b"3FQPZG%BS*f&XE#"25eaZ*bN0)#! J48j%8d9-4808$8914&"56d-0$3e38Np$)("XBAP6B@e`E'8SGQpZ,'&ZHLNJ5%& 14%a&$84&4L"KFQ9aG@9cG$%k8&45)&42)'P[BA9ND@mX$5!J)#"KFQ9aG@9cG$) kD@pKG@4TEb`0)#!J)(*PF'aj-6e158`k8&45)&42)'e`,!dJ)#!JFQ9`E(Nb28j *6$T39&)J9%mJEA!X$5!J)#"TEf%k8&45)&42)'P[BA9ND@mX$5!J)#"YEQpNC6T 39&)J9%mJE@iX$5!J)#"MD'P`BR9Q-6e158`k8&45)&42)%0)39)X$5!J)#"MD'P `BR9Q-Me158`k8&45)&42)%0)39)X$5!J)#"REcd`,!dJ)#!JC'9fD@0PCA*bEh) p-5`0)#!J)'pQCR0PG#`0)#!J)(4TE@9c,!dJ)#!JFQ9cG!d0)#!J58BJ+#!J)(* PF'aj-6Sp3h*PBA4P6A0R8'pbG#JT+6e158`J9%K&6L"5B@PcC5K&8Pp16e"28P3 T$5!J)%P')#JJ)#"bCA"XH6)k280bC@&dC8ecCe"[FR3S+5Np6NP-)&4)48iJ8Q& TFf8S49*I6Np36e*8+3dJ)#"*4L!SBA*PFA9PFh3a1Me$FQ9KG'9*6e*PFA9PFh3 SFQ9`E(Na,#"659T&6dBJD@pKG@4TEbNT28j*6#"85%91)&*KDA0P+%95Adj258p 549%T$3dJ)#![+L"hB@jd)(4[)'&XE'pMBA4P)'&ZC#"eFf8JB@jj)'0SB@jZC@` JGfPdD#"2F'9Z4'9f+#NJ+Lm0)#!JBA*PFA9PFh3a,QP[,QeZ,QaZ,R"bD6Sp384 "6%a23ep039K38N9$$5!J)'&bCA&eCA0d-5jTEbjMEfeYB@jN)#!k28&%3de%Ad& - -6%p$394&$5!J)'&bCA&eCA0d-5jTEbjQE'&RF`NJ1Me"4%P24Pp16eG"5930)#! JBA*PFA9PFh3a,Q&XE'pMDf9j#5!k26!0)#!JBA*PFA9PFh3a,Q4KG'%*)$Sp@c% X-L`d,$KG1N0)39)0)#!JBA*PFA9PFh3a,QaPEQGdD!NJ1Mdd1`dJ)#"*4L"NCAC TBf9PFR*[FMSp6h"PEN4PGQPMC5JRBA9ND@mZC'9fD@0P*b`J-#`JBA*PFA9PFh3 a,#!`+5"85%91)&*KDA0P+%95Adj24%9@580&+3d0)#!J,bSJBfp`H5"TEh*PFA9 PFh3JCQpb)'4[G@*XC5"LG@CQCA*PC#"[F'9bBA4TEfiJ+Lm0)#!JBA*PFA9PFh3 a,QP[,Q0[E@eKEQ3k28004&pA8NP843dJ)#"KFQ9aG@9cG$%ZD@mZCQaKCh-J)$S p384*6dCI8%959Np-$5!J)'&bCA&eCA0d-5j`CA*TEf3J)#!J1Me%DABSBfa[BfX X)(0KEA*KG'8T$5!J)'&bCA&eCA0d-5jfEfaeE@8J)#!J1MefEfaeE@80)#!JBA* PFA9PFh3a,Q0jBfaPFb!J)#!k26%0)#!J3fp`H8ePE5KKFQ9aG@9cG$%XBA*PFA9 PFh3b,#"659T&6dBJD@pKG@4TEbN0$3dJ)#"*4L"NBA4KE'9Z)$ip)$%f-cJd$5! J)#!J)%P')#KMD'P`BR9Q-6Sp3@aXEf0@C@-S1$%j-L`J68904Pp$5%P3+de&68C I8&9#6%P$+5Np6NP-)&4)48iJ8Q&TFf8S49*I6Np048dT$5!J)#!J)%P')#KMD'P `BR9Q-MSp3@aXEf0@C@-S1$%j-L`J68904Pp$5%P3+de&68CI8&9#6%P$+5Np6NP - -)&4)48iJ8Q&TFf8S49*I6Np048dT$3dJ)#!J)#"dD@ePFcSp#5"%DABSB@jk,#! J)$Ja16)T$5!J)#!J)#"bCA0d1MeKERSY6A9X+(4TE@9c,#!i-6Nb+3dJ)#!J)#" dD@ePFcSpG'PYCA-J,5!b$3dJ)#!J)#"YEQpNC3NJ)#!J)$SpBA*PFA9PFh3b$5! J)#!J)'eZEf4P,R*PF'ajF'pbG$SpFQ9`E(Nb$3dJ)#!J)#![+L"cC@jN)'CTFR0 d)(4hEb"LG@CQCA)RFb"QG@aX)(4[)'4PGQPMC5!U,`dJ)#!J)#"$Eh"j6@9Y+'4 KG'&`G()VGQpZ,#"MD'P`BR9Q-5`J1$%j-LN0)#!J)#!JEfCQFf9d1Mdi-6Nb$5! J)#!J)'&bCA&eCA0d-5jNBA4K)#!k2@0SDA"LG@Ba$5!J)#!J)'&bCA&eCA0d-5j XC@jRG'Jk26Ja16)0)#!J)#!JBQ9RD@j*6bKKFQ9aG@9cG$%T$5!J)#!J)%0[F(P 0C@dSC'&dBA"dFLYfEfiVEfCQFf9d,#"MD'P`BR9Q-L`J1$%j-LN0)#!J)#!JEfC QFf9d1Me[CQCcCA3J+b!i-6Nb$5!J)#!J)'&bCA&eCA0d-LjNBA4K)#!k2@0SDA" LG@Bb$5!J)#!J)'&bCA&eCA0d-LjXC@jRG'Jk26Ja16)0)#!J)#!JBQ9RD@j*6bK KFQ9aG@9cG$)T$5!J)#!J)'eZEf4P1MeKFQ9aG@9cG$%*#3N[+L"hB@Pd)'pZ)(* PFA9PFh3a)'CTFR0d)(4TE@8JBA*[G@jN)#S[$3dJ)#!J)#"549"&393*#3N*,bS JG@jdD@`JC'pZC5`JDf9PF#"QC@9ND@jR)'4KG'%JG'mJC'9fD@0P)#S[$3NJ9f& TG&"[FR3SE@j[C'8ZFQ9`E(P`Eh*d+3d*)%GPG%ecCb!J+'eZEf4P,R*PF'ajF'p bG#N0#5"TEf%k2@eZEf4P$3NJ58BJD@pK2@&bCA&eCA0d-3d*)#!J)'eZEf4P1Me KFQ9aG@9cG$)0#5"&6&0&$3NJ)#!JE@j[C'8k2@&bCA&eCA0d-3d*)%914%P'$3N J58BJG'PYCA-m2M!09h*TG'9'+#GFC#!JA'3J)#!JA'4FELFXBfKTF'*eCM%XBfK TF'*eCM)XD@pK,Q4KG'%T$3NJ)#!J3fp`H8ePE5KNBA4KF(4b+hC[ELY[CQCcCA3 X)'P[B5jNBA4K,#!i-6Nb+3d*)#!J)'P[B5jXC@jRG'Jk26Ja16)0#5!J)#"LC@G TENP2+'P[B5N0#5!J)#"[CQCcCA3k2@pQCR0PG#Xi-6Nb$3NJ)#!J4%9$)(4TE@9 c$3NJ48a648P')#KdD@ePFcd`+5""6N3J+(*PFh3m2M!T$9GbDA4P4LJRA'3J)&a N)#!J)&aNA'iR,'0SDA"LG@Ba,'0SDA"LG@Bb,'P[B5jNBA4K+3d*)#!J)%0[F(P 0C@dSC'&dBA"dFLYfEfiVEfCQFf9d,#"TEf%ZC'&dB5`JFQ9cG#N0#5!J)#"TEf% ZE'9ZCh4S1MebCA0d$3NJ)#!JBQ9RD@j*6bKTEf%T$3NJ)#!JFQ9cG$Sp-!d*)%9 - -8d80#5!J)#"REcSp-3d*)#!J)&GKDA43Eh*d+'eZEf4P,R*PF'ajF'pbG#N0#5! J)#"(CA40FfFJ)#KYEQpNC5jbCA"XHA"[FR3T$3NJ48j%58B0)#!J)#!J98j858` JCfmp-3d0)#!J48a643dJ)#!J)#"*4L!SBfKTF'*eCM%k28&XE'pM9Q9M+'&ZHL` J68904Pp$5%P3+de&68CI8&9#6%P$+5Np6NP-)&4)48iJ8Q&TFf8S49*I6Np048d T$3dJ)#!J)#"YEQpNC3NJ)#!J)$SpBA*PFA9PFh3a$5!J)#!J)'eZEf4P,R*PF'a jF'pbG$SpFQ9`E(Na$5!J)#!J)%0[F(P0C@dSC'&dBA"dFLYfEfiX)'0SDA"LG@B a,#"KERST$5!J)#!J)'&bCA&eCA0d-5jNBA4K)#!k2@0SDA"LG@Ba$5!J)#!J)'& bCA&eCA0d-5jXC@jRG'Jk2@&ZHJdJ)#!J)#"LC@GTENP2+'&bCA&eCA0d-5N0)#! J)#!J9f&TG&"[FR3SE@j[C'8ZFQ9`E(P`Eh*d+3dJ)#!J)#"(CA40FfFJ)#KYEQp NC5jbCA"XHA"[FR3T$5!J)%914%P'$3e&@%0&8&3J4%m0)#!J58BJBfKTF'*eCM) *)#!J)&4)48iJ4R*PC9CPB`NSBfKTF'*eCM)T$5!J)%P')'0SDA"LG@Ba#5!J)#" 85%91)%CbC@9@C@-*+'0SDA"LG@Ba+3dJ)#"*4L"NCACTBf9PFR*[FMd`)&4)48i J3fa[Ff9%CACTBf8*+'&bCA&eCA0d-5N0)#!J58BJBA*PFA9PFh3a)#!J)#"85%9 1)%4PE'9dC8P28Q9aG@9cG#KKFQ9aG@9cG$%T$5!J)%P')(*PF'aj-JNJ)#!J9%K &6L"%C@aPG'90FfG3Eh*d#5KbCA"XH6)T$5!J)%P')(*PF'aj-3NJ)#!J9%K&6L" %C@aPG'90FfG3Eh*d#5KbCA"XH6%T$5!J)&0&6%9$9#"PH'0PF(4TEfi0)#!J)#! J3d&645"&8Pp16de&65!J)$XJ8(*TER4'+#GZEb"YC@e[FRPFELFT$5!J)#!J)%0 "8d8J49*I6Np36e*8)#!l)&"bD@jd4LJRBfpeE'3JEQpd)'0bC@&dC5"`Eh*dA'i R+3dJ)#!J)#"$390&)%95Adj258p549%J1b"3FQPZG%BS*f0[G@aN)'j[G#"MFQ9 KG'8JD@pbCA&eCA0dA'iR+3dJ)#!J)#"$390&)%95Adj24%9@580&1b"3FQPZG%B S*f0[G@aN)'j[G#"[F'9Z)'&eC'P[,@4PGQPMC9aZ*bN0)#!J)#!J3d&645"&8Pp 16dj&)#!J)$XJ8(*TER4'+#GKE'`J6dYFELFT$5!J)%914&0&6%9$9!e&6N438Np $$3eqr`!!: - --=====================_910675363==_ Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable ============================================================ // Rainer M|ller A1200-030-50MHz 16MB/850MB // Pentium 166MHz 32MB/2.1GB // have a look at: Aminet:mus/edit/SampleE \\ // \X/ AMIGA for ever ! - --=====================_910675363==_-- @endnode @node ID6_0 "subscribe? (ID6_0)" From: dissident@mail.telepac.pt (Roberto) Date: Thu, 05 Nov 1998 02:13:02 +0100 Subject: subscribe? What's the procedure to subscribe this list? - -- rOBERTo ->dissident@mail.telepac.pt<- ICQ:14501808 @endnode @node ID7_0 "MUI problem (ID7_0)" Date: Thu, 5 Nov 1998 12:27:56 +0100 (MET) From: szczepan@student.man.bialystok.pl ("Marcin Juszkiewicz (Szczepan/BlaBla)") Subject: MUI problem Hi In my program I had : DEF linia linia := RectangleObject, MUIA_RectangleHBar, MUI_TRUE, MUIA_Weight,1 End and later in GUI definition : Child, linia, Child, ... But it doesn't works - next Childs are coming or not. But when I insert : Child, RectangleObject, -> other like in linia definition End, Child, ... It works ok. Why ? - ------ Marcin Juszkiewicz (Szczepan/BlaBla) *Team Amiga* szczepan@student.man.bialystok.pl http://student.man.bialystok.pl/szczepan/ A1200 BlizzIv 2+8MB RAM 425MB HDD x8 CD Author of MultiView for OS 2.0+ -> Aminet:util/sys/2b_mv_os2_x.lha @endnode @node ID7_1 "MUI problem (ID7_1)" Date: Thu, 05 Nov 1998 16:56:44 +0100 From: gamboni@fastnet.ch (Maxime Gamboni) Subject: Re: MUI problem Marcin Juszkiewicz (Szczepan/BlaBla) wrote: > Hi > > In my program I had : > > DEF linia > > linia := RectangleObject, > MUIA_RectangleHBar, MUI_TRUE, > MUIA_Weight,1 Forgot a comma here. But I guess this is just some typo mistake, as EC would have remarked it. > End > > and later in GUI definition : > > Child, linia, > Child, ... > > But it doesn't works - next Childs are coming or not. But when I insert : The code seems right... I do not understand what happens. What do you mean here? > > > Child, RectangleObject, -> other like in linia definition > End, > Child, ... > > It works ok. > > Why ? That's very strange. Are you sure that you wrote exactely the same code in both cases and that you are using your linia variable exactely once (i.e. not give it twice or more as children)? Maxime @endnode @node ID8_0 "Another small survey (ID8_0)" Date: Thu, 5 Nov 1998 13:46:02 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Another small survey As there is not a stated limit for the length of the filenames (path+name), or however, not one that I am aware of, I usually write my programs to support filenames of at least 256 chars. I think this should be enough for many subdirectories (at least 7 of 32 bytes, that should be the maximum lenght allowed for the name of a file, and the name of the file itself). Do you know if the filesystem has an harcoded limit (has it some fields in his structures that limit the size of the paths)? What is the filename size do you usually support in your programs? Thanks M&F @endnode @node ID8_1 "Another small survey (ID8_1)" From: Peter.Karlsson@swipnet.se (Peter Karlsson) Date: Thu, 05 Nov 1998 14:13:37 +0100 Subject: Re: Another small survey Hello mauro Look what mauro fontana wrote 05-Nov-98: > As there is not a stated limit for the length of the filenames > (path+name), or however, not one that I am aware of, I usually write my > programs to support filenames of at least 256 chars. One quick look at EMODULES:dos/dos.m shows this: (----) OBJECT fileinfoblock ( 0) diskkey:LONG ( 4) direntrytype:LONG ( 8) filename[108]:ARRAY OF CHAR <-- ( 116) protection:LONG ( 120) entrytype:LONG ( 124) size:LONG ( 128) numblocks:LONG ( 132) datestamp:datestamp (or ARRAY OF datestamp) ( 144) comment[80]:ARRAY OF CHAR ( 224) owneruid:INT ( 226) ownergid:INT ( 228) reserved[32]:ARRAY OF CHAR (----) ENDOBJECT /* SIZEOF=260 */ However, a C include file shows the following: struct FileInfoBlock { LONG fib_DiskKey; LONG fib_DirEntryType; /* Type of Directory. If < 0, then a plain file. * If > 0 a directory */ char fib_FileName[108]; /* Null terminated. Max 30 chars used for now */ LONG fib_Protection; /* bit mask of protection, rwxd are 3-0. */ LONG fib_EntryType; LONG fib_Size; /* Number of bytes in file */ LONG fib_NumBlocks; /* Number of blocks in file */ struct DateStamp fib_Date;/* Date file last changed */ char fib_Comment[80]; /* Null terminated comment associated with file */ /* Note: the following fields are not supported by all filesystems. */ /* They should be initialized to 0 sending an ACTION_EXAMINE packet. */ /* When Examine() is called, these are set to 0 for you. */ /* AllocDosObject() also initializes them to 0. */ UWORD fib_OwnerUID; /* owner's UID */ UWORD fib_OwnerGID; /* owner's GID */ char fib_Reserved[32]; }; /* FileInfoBlock */ This suggests that the filename has max 30 chars. Regards - -- Peter Karlsson. Amiga User. ICQ #15875673 @endnode @node ID8_2 "Another small survey (ID8_2)" Date: Thu, 05 Nov 1998 09:19:09 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Another small survey Peter Karlsson wrote: > > Hello mauro > > Look what mauro fontana wrote 05-Nov-98: > > > As there is not a stated limit for the length of the filenames > > (path+name), or however, not one that I am aware of, I usually write my > > programs to support filenames of at least 256 chars. > > I know that it is not written explicitely anywhere but the max lenght of a filename IS 30 chars and the maximum length for the path is 107 chars (but I'm not sure 107 chars includes the filename, but I think so).. try it creating something larger, the system will warn you or truncate the name for you! - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID8_3 "Another small survey (ID8_3)" Date: Thu, 5 Nov 1998 15:32:06 +0100 (MET) From: subvcbhd@calvados.zrz.TU-Berlin.DE (Henk Jonas) Subject: Re: Another small survey On Thu, 5 Nov 1998, Maxim Olivier-Adlhoch wrote: > Peter Karlsson wrote: > >=20 > > Hello mauro > >=20 > > Look what mauro fontana wrote 05-Nov-98: > >=20 > > > As there is not a stated limit for the length of the filenames > > > (path+name), or however, not one that I am aware of, I usually write = my > > > programs to support filenames of at least 256 chars. > >=20 > > >=20 > I know that it is not written explicitely anywhere but the max lenght of = a > filename IS 30 chars and the maximum length for the path is 107 chars (bu= t I'm > not sure 107 chars includes the filename, but I think so).. This limitation comes only from the FastFileSystem, differnt FileSystem have different limitations. So PLEASE use more then only 30 chars for the filename and 107 chars for the complete name. Maybe i think also 256 inlucde the "0" is a very compatible way to hold the complete path and also the single filename (try to imagine you use a FileSystem for long Win95 filenames, they are up to 256 chars) Henk - ---------------------------------------------------------------- Henk Jonas | subvcbhd@linux.zrz.tu-berlin.de Student der | Energietechnik | http://www.cs.tu-berlin.de/~jonash > Ich lehne Atomenergie als Energiealternative ab! niX=B3 Castor < - ---------------------------------------------------------------- * AmigaMetaFileFormat * MetaView * Messlabor * Voxelflight * - ---------------------------------------------------------------- Fuer die 'Mitleser': ANARCHIEBNDAKWPKKRAFRADIKALTNTKPDPDSREVOLUT @endnode @node ID8_4 "Another small survey (ID8_4)" Date: Thu, 05 Nov 1998 16:57:48 +0100 From: gamboni@fastnet.ch (Maxime Gamboni) Subject: Re: Another small survey Hello. Henk Jonas wrote: > On Thu, 5 Nov 1998, Maxim Olivier-Adlhoch wrote: > > > Peter Karlsson wrote: > > > > > > Hello mauro > > > > > > Look what mauro fontana wrote 05-Nov-98: > > > > > > > As there is not a stated limit for the length of the filenames > > > > (path+name), or however, not one that I am aware of, I usually write my > > > > programs to support filenames of at least 256 chars. > > I know that it is not written explicitely anywhere but the max lenght of a > > filename IS 30 chars and the maximum length for the path is 107 chars (but I'm > > not sure 107 chars includes the filename, but I think so).. > This limitation comes only from the FastFileSystem, differnt FileSystem > have different limitations. So PLEASE use more then only 30 chars for the > filename and 107 chars for the complete name. Maybe i think also 256 > inlucde the "0" is a very compatible way to hold the complete path and > also the single filename (try to imagine you use a FileSystem for long > Win95 filenames, they are up to 256 chars) I remember reading that the new FastFileSystem (the one that displayed that dreadful warning message at startup some weeks ago ;-) was supposed to support 128 char long filenames. I haven't found this again, so I'm not sure, but I know that that future filesystem _will_ support more than thirty chars. Maxime @endnode @node ID8_5 "Another small survey (ID8_5)" Date: Fri, 6 Nov 1998 08:32:24 +0100 (MET) From: szczepan@student.man.bialystok.pl ("Marcin Juszkiewicz (Szczepan/BlaBla)") Subject: Re: Another small survey On Thu, 5 Nov 1998, Maxim Olivier-Adlhoch wrote: - ->> > As there is not a stated limit for the length of the filenames - ->> > (path+name), or however, not one that I am aware of, I usually write my - ->> > programs to support filenames of at least 256 chars. - -> - ->I know that it is not written explicitely anywhere but the max lenght of a - ->filename IS 30 chars and the maximum length for the path is 107 chars (but I'm - ->not sure 107 chars includes the filename, but I think so).. You always can use relative path so 256 for full path+name can be not enough. This problem was on c.s.a.p. about one year ago. - ------ Marcin Juszkiewicz (Szczepan/BlaBla) *Team Amiga* szczepan@student.man.bialystok.pl http://student.man.bialystok.pl/szczepan/ A1200 BlizzIv 2+8MB RAM 425MB HDD x8 CD Author of MultiView for OS 2.0+ -> Aminet:util/sys/2b_mv_os2_x.lha @endnode @node ID8_6 "Another small survey (ID8_6)" Date: Fri, 6 Nov 1998 09:19:46 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Another small survey > ->> > As there is not a stated limit for the length of the filenames ->> > > (path+name), or however, not one that I am aware of, I usually write > my ->> > programs to support filenames of at least 256 chars. -> ->I > know that it is not written explicitely anywhere but the max lenght of a > ->filename IS 30 chars and the maximum length for the path is 107 chars > (but I'm ->not sure 107 chars includes the filename, but I think so).. > > You always can use relative path so 256 for full path+name can be not > enough. This problem was on c.s.a.p. about one year ago. Ok, that's exacly what I meant (though as said before 256 is enough for 7 sub directories and the filename itself if all are 32 chars long). However, once the problem has been identified, a solution should be found as well. So the question remains... taken that 30 il the maximum limit of a file name, and that 256 chars could not be enough, well what is the most reasonable number for you? Following your idea any number is enough as fixed one I can always create as many relative paths as I want in order to go beyond it. This is more a matematical statement, and can be applied practically everywhere in the programming field. The solution is to use reasonable values that are going to suit most of the cases without wasting too much resources to support cases that are not going to happen very often (or not at all). So, is 512 a better number? Or 1024? or 2048? I though 256 was good enough... what do you use in your programs? M&F P.S. I don't read the C.S.A.x newsgroups but very rarely. So probably you can send the solution they found there (if they ever found one). @endnode @node ID8_7 "Another small survey (ID8_7)" Date: Fri, 6 Nov 1998 09:24:55 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Another small survey > One quick look at EMODULES:dos/dos.m shows this: > > (----) OBJECT fileinfoblock > ( 0) diskkey:LONG > ( 4) direntrytype:LONG > ( 8) filename[108]:ARRAY OF CHAR <-- [...] > struct FileInfoBlock { > LONG fib_DiskKey; > LONG fib_DirEntryType; /* Type of Directory. If < 0, then a plain > file. > * If > 0 a directory */ > char fib_FileName[108]; /* Null terminated. Max 30 chars used for now [...] All right, but this applies for file names, that is the only for the name of the file and not its complete path. The problem is how many of this 30 (or 32) chars can be put together before going outside some hardcoded limits in the filesystem(s) (if one ever exists) and which is the best supposed number to use in order to maximize cost/performance (meant as most probable case suppported related with the use of resources). M&F @endnode @node ID8_8 "Another small survey (ID8_8)" Date: Fri, 06 Nov 1998 11:42:21 +0100 From: ss37@irz301.inf.tu-dresden.de (Sven Steiniger) Subject: Re: Another small survey > However, once the problem has been identified, a solution should be found > as well. So the question remains... taken that 30 il the maximum limit of > a file name, and that 256 chars could not be enough, well what is the most > reasonable number for you? > > So, is 512 a better number? Or 1024? or 2048? I though 256 was good > enough... what do you use in your programs? I always use 256, E-strings and exception-handler. It works like this: RAISE "adpt" IF AddPart()=DOSFALSE -> I'am not sure about DOSFALSE ... AddPart(my_estring, new_subdir, StrMax(my_estring)) SetStr(my_estring, StrLen(my_estring)) So you always get an exception if filename is too long. - -- Sven Steiniger (ss37@inf.tu-dresden.de - http://www.inf.tu-dresden.de/~ss37) And always remember: Heaven is not a place, it's a feeling. (..."Happiness is not a state; it's a process.", Ali Graham) @endnode @node ID8_9 "Another small survey (ID8_9)" From: frosetti@hotmail.com ("Dennis Andersson") Subject: Re: Another small survey Date: Fri, 06 Nov 1998 03:08:03 PST > >> However, once the problem has been identified, a solution should be found >> as well. So the question remains... taken that 30 il the maximum limit of >> a file name, and that 256 chars could not be enough, well what is the most >> reasonable number for you? >> >> So, is 512 a better number? Or 1024? or 2048? I though 256 was good >> enough... what do you use in your programs? > >I always use 256, E-strings and exception-handler. It works >like this: > >RAISE "adpt" IF AddPart()=DOSFALSE -> I'am not sure about DOSFALSE >... > AddPart(my_estring, new_subdir, StrMax(my_estring)) > SetStr(my_estring, StrLen(my_estring)) > >So you always get an exception if filename is too long. > I always use 1024 to be on the safe side. Dennis ______________________________________________________ Get Your Private, Free Email at http://www.hotmail.com @endnode @node ID9_0 "CSV to guide problem (ID9_0)" Date: Fri, 6 Nov 1998 10:29:26 GMT From: I2683@www2.uportu.pt (Mark Marques) Subject: CSV to guide problem hello ... I am trying to program a small program that can convert a simple text to an Amigaguide file... Is there anyone how to make E recognize "escape codes" like "[31m" or similar an tranform them into Aguide nodes ? I tried something like reading a complete line of the text and then aplly a char by char routine ... but when it reaches those escape codes it simply reports an error ... What am I doing wrong ? MArk MArques @endnode @node ID9_1 "CSV to guide problem (ID9_1)" Date: Fri, 06 Nov 1998 11:46:52 +0100 From: ss37@irz301.inf.tu-dresden.de (Sven Steiniger) Subject: Re: CSV to guide problem > I am trying to program a small program that can convert a simple text to an > Amigaguide file... > Is there anyone how to make E recognize "escape codes" like "[31m" or > similar an tranform them into Aguide nodes ? > I tried something like reading a complete line of the text and then aplly a > char by char routine ... but when it reaches those escape codes it simply > reports an error ... Did EC report an error or your program? In the first case please remember that "escape codes" are no characters but character sequences. So you must check for character "[31" and then for "m". Maybe that's the problem. And the second case is your fault :( If nothing helps, you should send the "char by char" routine to this list. Ciao. - -- Sven Steiniger (ss37@inf.tu-dresden.de - http://www.inf.tu-dresden.de/~ss37) And always remember: Heaven is not a place, it's a feeling. (..."Happiness is not a state; it's a process.", Ali Graham) @endnode @node ID9_2 "CSV to guide problem (ID9_2)" From: M.Tjoelker@nl.cis.philips.com (Menno Tjoelker) Subject: Re[2]: CSV to guide problem Date: Sat, 7 Nov 98 19:36:40 -0100 Sven Steiniger wrote about Re: CSV to guide problem: > > I am trying to program a small program that can convert a simple text t= o an > > Amigaguide file... > > Is there anyone how to make E recognize "escape codes" like "[31m" or > > similar an tranform them into Aguide nodes ? > > I tried something like reading a complete line of the text and then apl= ly a > > char by char routine ... but when it reaches those escape codes it simp= ly > > reports an error ... > Did EC report an error or your program? In the first case please > remember that "escape codes" are no characters but character > sequences. So you must check for character "[31" and then for > "m". Maybe that's the problem. And the second case is your fault :( This is wrong. The sequences begin with either CSI ($9B) or ESC-[, these should be considered equal. The digits are ASCII characters. Other characters than digits also occur. Multiple arguments are separated by a semicolon. The end of the sequence is: "@"=A0<=3D=A0character=A0<=3D=A0"~",= possibly preceded by a space (this makes a difference). It is not known what the arguments mean until the end of the sequence has been reached. This is a little irritating but avoids the problems of formats with the number at the end - what if a digit follows the sequence? If you are using a character by character routine, why do you read a line at a time? This may cause trouble if a line is too long. The DOS function UnGetC() is useful when reading a character at a time (it is not necessary when parsing escape codes, though). Jilles Tjoelker - -- - --- Jilles Tjoelker | Craterlaan 6 | Tel. : +31.40.2427420 5632 AG Eindhoven | Fax : +31.40.2427420 (on request) The Netherlands | *** Author of Iris (mailer), Activity (activity meter), *** *** Select_Host (NapsaTerm frontend), Solitaire (WB game), *** *** Metronome (tool for musicians), etc. *** @endnode @node ID9_3 "CSV to guide problem (ID9_3)" Date: Mon, 9 Nov 1998 12:34:25 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: CSV to guide problem On Fri, 6 Nov 1998, Mark Marques wrote: > hello ... > I am trying to program a small program that can convert a simple text to an > Amigaguide file... > Is there anyone how to make E recognize "escape codes" like "[31m" or > similar an tranform them into Aguide nodes ? > I tried something like reading a complete line of the text and then aplly a > char by char routine ... but when it reaches those escape codes it simply > reports an error ... > What am I doing wrong ? A am not sure if I have understood what you mean here. If you are trying to transform ANSI codes into AmigaGuide codes (not nodes) well, you should interpret all the chars that make up an ANSI code till you understand the meaning of that escape code and transform it in the relative AMigaGuide codes. I do not know ANSI codes, but I think doing a direct transformation should not be that difficult. The fact that the program cannot interpret the escape character is a problem related with your own program not AmigaE. A char is a number and so you are always able to do comparisons to know what character is (if you compre succesfully a char with 13 you know you get a CarriageReturn char, if the right comparison is with 8 you get a tab and so on). This way you can interpret even character that are not printable but are part of the ASCII file. Reading a line at time is not an error, but firstly it is useless in this situation and secondly you have to be sure the space you allocatefor the line is always enough to store a line of a general length (so you should use a dynamic allocation that expands as the length of the line to load its bigger than the size of the already allocated buffer). Using a fixed length may be good for a particular purpose but not fr general usage. Is there a list of escape codes somewhere so that I can use them myself? M&F @endnode @node ID10_0 "OBJECTS and getting the size of data (ID10_0)" Date: Mon, 9 Nov 1998 04:17:26 -0800 (PST) From: digitaldave98@yahoo.com (David Arbuthnot) Subject: OBJECTS and getting the size of data Hi All, I am writing some data to a file from an object and i have a few problems (1). How can i get the size of the memory the element points to ??? OBJECT bla bla:LONG ENDOBJECT PROC savebla(outfile) OF bla IS Fwrite(outfile,self.bla,6,1) PROC main() DEF b:PTR TO bla,outfile NEW bla bla.bla:='blabla' IF outfile:=Open('blabla.test',NEWFILE) b.savebla(outfile) Close(outfile) ENDIF ENDPROC The above works but i know for a fact the data is not always going to be 6 bytes long for example if bla.bla:='blablabla' the output to file would still be "blabla" Help if possible and please send some examples otherwise i will check in to a mental asylum !!!!!!!! On an opposite note (reading data) (2). Once i have written some binary data to a file how can i figure out what the data is supposed to be i know that i can use "seek" but dont know how to use the function ??? BTW how do i get the data once seek has found it ??? < Digital Dave 98 > (Or For those of you that read in Hex) $60326873717384657632686586693257563262 E + MUI = Easier GUI coding C + MUI = The most complex high level language this side of the sun and the best GUI coding system in this universe Amiga = The only computer you can run a billion programs on at once (Provided you've got enough memory of course) PC = The only computer this side of the sun that wont do anything unless you give it 2,000,000 Gigs of memory or a kick up the rear end
DO YOU YAHOO!?
Get your free @yahoo.com address at Yahoo! Mail.
@endnode @node ID11_0 " (ID11_0)" Date: Mon, 9 Nov 1998 13:38:31 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: I had problem with this HTML mail, so sorry if it does not look right for you, but it didn't fo mee too. The above works but i know for a fact the data is not always going to be 6 bytes long for example if bla.bla:='blablabla' the output to file would still be "blabla" Help if possible and please send some examples otherwise i will check in to a mental asylum !!!!!!!! It quite simple as bla is just a string. You can simply use StrLen(bla) to know its size: len := StrLen(bla) and len is going to hold its length depending on how defined it. (2). Once i have written some binary data to a file how can i figure out what the data is supposed to be i know that i can use "seek" but dont know how to use the function ??? BTW how do i get the data once seek has found it ??? I have not understood here. You write binary data to a file and then you try to get them back again? 1) You can use your on copy of the data not those in the file. 2) If you want to verify the data you wrote then I would not use Seek() as not all devices are able to handle a backward seek (pipe for example). If you are going to verify the written data only at the end of the file, that is when you have written all the binary data, it is much simpler to reload the complete file again once you have closed it. Can you give more info? M&F P.S. Please don't use HTML format in your e-mail. Some of us are still using old programs that are not able to handle it. It is quite useless to have HTML code in the mail, so, please, don't use it. I had to do some manual formatting to this mail. It is quite annoying and not a good thing one wants to do for every e-mail. @endnode @node ID11_1 " (ID11_1)" Date: Mon, 9 Nov 1998 13:43:06 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: On Mon, 9 Nov 1998, mauro fontana wrote: > It quite simple as bla is just a string. You can simply use StrLen(bla) to > know its size: > > len := StrLen(bla) Opps!!! It is len := StrLen(bla.bla) 8) M&F @endnode @node ID11_2 " (ID11_2)" Date: Mon, 9 Nov 1998 04:46:05 -0800 (PST) From: digitaldave98@yahoo.com (David Arbuthnot) Subject: Re: - ---mauro fontana wrote: > > I had problem with this HTML mail, so sorry if it does not look right for > you, but it didn't fo mee too. > > The above works but i know for a fact the data is not always > going to be 6 bytes long for example > if bla.bla:='blablabla' the output to file would still be "blabla" > > Help if possible and please send some examples otherwise i will > check in to a mental asylum !!!!!!!! > > It quite simple as bla is just a string. You can simply use StrLen(bla) to > know its size: > > len := StrLen(bla) > > and len is going to hold its length depending on how defined it. > > > (2). Once i have written some binary data to a file how can i > figure out what the data is supposed to be i know that i > can use "seek" but dont know how to use the function ??? > > BTW how do i get the data once seek has found it ??? > > I have not understood here. You write binary data to a file and then you > try to get them back again? > 1) You can use your on copy of the data not those in the file. > 2) If you want to verify the data you wrote then I would not use Seek() as > not all devices are able to handle a backward seek (pipe for example). If > you are going to verify the written data only at the end of the file, that > is when you have written all the binary data, it is much simpler to > reload the complete file again once you have closed it. > > Can you give more info? > > M&F > > P.S. Please don't use HTML format in your e-mail. Some of us are still > using old programs that are not able to handle it. It is quite useless to > have HTML code in the mail, so, please, don't use it. I had to do some > manual formatting to this mail. It is quite annoying and not a good thing > one wants to do for every e-mail. > > > Sorry About That I must have clicked on the use HTML function anyway what i am trying to do is create a prefs object for an program i wrote about two days ago and i want to save the file as a binary as it contains data such as passwords and things that need to be kept secret to the more "explorative amiga user" so i need to write the data which may not be a string it could maybe be some hex value or the like then i need to read it back each time the program is loaded thanks for the help and sorry about the html thing again == < Digital Dave 98 > (Or For those of you that read in Hex) $60326873717384657632686586693257563262 E + MUI = Easier GUI coding _________________________________________________________ DO YOU YAHOO!? Get your free @yahoo.com address at http://mail.yahoo.com @endnode @node ID11_3 " (ID11_3)" Date: Mon, 9 Nov 1998 14:36:22 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: > Sorry About That I must have clicked on the use HTML function anyway > what i am trying to do is create a prefs object for an program i wrote > about two days ago and i want to save the file as a binary as it > contains data such as passwords and things that need to be kept secret > to the more "explorative amiga user" so i need to write the data which > may not be a string it could maybe be some hex value or the like then > i need to read it back each time the program is loaded > > thanks for the help and sorry about the html thing again Ok. I have understood now. The simpler thing you can do is having a buffer where you put the data you need and then save it at once as a file. This may look this way. OBJECT prefs buffer:LONG -> It is a PTR TO CHAR size:LONG -> Keeps the allocated size of the buffer ENDOBJECT I think you cannot do OOP, so I'll use normal AmigaE code. CONST BUF_SIZE=$100 -> Can be anything you need here PROC main() DEF p=0:PTR TO prefs, pos=0 NEW p p.buffer := New(BUF_SIZE) p.size := BUF_SIZE /* Now you fill the buffer with the data of your prefs. You can use CopyMem() for this purpose and a varable that keeps the position in the buffer that has already been used. */ CopyMem('Preference', p.buffer, 10) pos := 10 p.buffer[pos++] := 100 p.buffer[pos++] := 25 ... /* You insert binary data this way. Note: I have declared buffer as a LONG (PTR TO CHAR) so only nunber from 0 to 256 have meaning here. If you declare it as a PTR TO INT o PTR TO LONG you can write 2 or 4 bytes at time and number can be in the range, respectively, -2^15 - 2^15 or -2^31 - 2^31 (don't want to do the calculation now 8)). At the same time pos must be declared as a PTR TO INT or PTR TO LONG so that the ++ operator is going to add 2 or 4 at pos. Once you have written your buffer, you just save it with any write function (Write() or Fwrite()) passing the BUF_SIZE as the size of the buffer you are going to save. ENDPROC This is just one mode on how to solve this problem. Here another simpler one PROC main() DEF p=0:PTR TO prefs, buf=0:PTR TO CHAR -> This must be the same as -> p.buffer NEW p p.buffer := New(BUF_SIZE) p.size := BUF_SIZE /* Now fill the buffer but keep a copy of the starting address of the buffer in buf */ buf := p.buffer buf[]++ := 10 buf[]++ := 20 buf[]++ := 30 .... CopyMem([40, 50, 60, 70, 80]:PTR TO CHAR, buf, 5) buf := buf+5 -> This is 5 as they were CHAR. For INT this would have -> been 10 and for LONG it would have been 20 .... buf[]++ := 90 /* Use any way to fill the buffer with the data you want. Remember to use the correct PTR TO declarations for all pointers you are going to use for buffer, that must be equal to that of p.buffer. */ /* Now save it. I can remember the right parameters for the open and write functions but you can find them on the autodocs. */ fh := Open(myfile, NEWFILE) Write(fh, p.buffer, p.size) Close(fh) ENDPROC Now you should have a file whose name as contained in myfile BUF_SIZE large. You can also keep the actual size of the used buffer in p.size instead f its total size, so that you are going to save only that part of the buffer that you have used. This may be look a bit confused and probably it is. If you have some problem feel free to write me. Maybe some one else on this list knows a better way to do this things (expecialy a good way to fill the buffer in a easy way). M&F @endnode @node ID12_0 "-none- (ID12_0)" From: frosetti@hotmail.com ("Dennis Andersson") Subject: Re: -none- Date: Mon, 09 Nov 1998 05:52:53 PST > >Sorry About That I must have clicked on the use HTML function anyway >what i am trying to do is create a prefs object for an program i wrote >about two days ago and i want to save the file as a binary as it >contains data such as passwords and things that need to be kept secret >to the more "explorative amiga user" so i need to write the data which >may not be a string it could maybe be some hex value or the like then >i need to read it back each time the program is loaded > If you really want to keep it secret you should use crypto. RC4 is a fast and safe algorithm. Mail me if you want the RC4 source. Dennis ______________________________________________________ Get Your Private, Free Email at http://www.hotmail.com @endnode @node ID13_0 "UUEncode/Decode Src (ID13_0)" Date: Mon, 9 Nov 1998 16:51:44 +0100 (CET) From: szczepan@student.man.bialystok.pl ("Marcin Juszkiewicz (Szczepan/BlaBla)") Subject: UUEncode/Decode Src Hi Is anyone has E Source of UU Encode/Decode programs ? I need uuencode procedure for my program. Now I'm using external GGuucode but I want to have it all in one proggy. - ------ Marcin Juszkiewicz (Szczepan/BlaBla) *Team Amiga* szczepan@infeco.pb.bialystok.pl http://student.man.bialystok.pl/szczepan/ A1200 BlizzIv 2+8MB RAM 425MB HDD x8 CD Author of MultiView for OS 2.0+ -> Aminet:util/sys/2b_mv_os2_x.lha @endnode @node ID14_0 "Problems with c->e converting (ID14_0)" From: tommy@pitea.mail.telia.com (Tommy Lindgren) Date: Mon, 09 Nov 1998 18:41:51 +0200 Subject: Problems with c->e converting Hi! You might have noticed that a library called "mmu.library" has been uploaded to Aminet. However, I did and downloaded it, but just to discover that no E modules were included. "Shit" I = thought and tried to convert the pragma file with pragma2module. But p2m failed (the output file was only 4 bytes !). So now I try to convert all includes to modules by hand. At the moment = I have problems with the following piece of code: struct MappingNode { = ... ... union { void *map_UserData; /* your data if this is invalid o= r swapped */ void *map_Page; /* destination page if bundled */= LONG *map_Descriptor;/* pointer to a descriptor, alter= natively */ LONG map_Delta; /* added to the logical address i= f remapped */ } map_un; }; What is the "union" part equal to in E? And another problem (which = already has been answered in this m/l, sorry): = What is "1<<14L" equal to? - -- = Tommy Lindgren - tomyl@telia.com http://w1.911.telia.com/~u91103938 = ICQ UIN: 13659426 = Murphy's Laws of Combat - No. 8 Teamwork is essential, it gives them someone else to shoot at. @endnode @node ID14_1 "Problems with c->e converting (ID14_1)" Date: Tue, 10 Nov 1998 17:50:59 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Problems with c->e converting On Mon, 9 Nov 1998, Tommy Lindgren wrote: => union { => void *map_UserData; /* your data if this is invalid or swapped */ => void *map_Page; /* destination page if bundled */ => LONG *map_Descriptor;/* pointer to a descriptor, alternatively */ => LONG map_Delta; /* added to the logical address if remapped */ => } map_un; =>}; => => =>What is the "union" part equal to in E? The union says that every definition in it shares the same space in the datastructure. Therefore, the overall size of the union part is equal to the biggest single item, not the addition of the size of all the items as is normal. So for example: with union (b & c in same space)| without union (b & c seperate) | struct blah { | struct blah { LONG a; | LONG a; union { WORD b; LONG c; } foo;| WORD b; LONG c; LONG d; | LONG d; }; | }; | member offset size | member offset size a 0 4 | a 0 4 b 4 2 | b 4 2 c 4 4 | c 6 4 d 8 4 | d 10 4 overall 12 | overall 14 E does not (and probably never will) allow you useful things like unions. So how do we fix this into E? We can either hack into the object module after creating it (as they did with the Amiga includes for E), or we can put only one of the union members into the structure and make #defines for all the other members so they mean the same thing. So, from your example: OPT PREPROCESS OPT MODULE OPT EXPORT -> you have to export every single thing just to get one #define -> exported #define map_userdata map_page #define map_descriptor map_page #define map_delta map_page OBJECT blah ... map_page ... ENDOBJECT Unfortunately, this means all the unioned identifiers have to have the same type. What a great language feature! =>What is "1<<14L" equal to? Shl(1,14) or, if we defined the below, it would be the const FOURTEEN. SET ZERO, ONE, TWO, THREE, FOUR, FIVE, SIX, SEVEN, EIGHT, NINE, TEN, ELEVEN, TWELVE, THIRTEEN, FOURTEEN Another great thing! E relies on function calls to do basic math, and therefore prevents you from using particular kinds of calculated constant values. (Mostly numbers with shifts and negations.) Also SET does not allow you to write 'SET FOURTEEN=14' like ENUM allows you. Stuart @endnode @node ID14_2 "Problems with c->e converting (ID14_2)" From: jason@fsel.com ("Jason Hulance") Subject: RE: Problems with c->e converting Date: Wed, 11 Nov 1998 08:54:11 -0000 Tommy Lindgren wrote: > What is the "union" part equal to in E? Unions are for when the same bit of memory might be used for several different structures. You normally have something outside the union that dictates what shape the union data will have, so it can be accessed safely. Unions are a silly complication in a language. If your data may have different shapes then it ought to be described by separate types. That's what I'd recommend you'd do normally. But, for converting someone else's C datatype, you really want to keep the same single type (so that translating C code that uses it is a little easier). Most importantly, the AmigaOS system modules needed to do this. The E module format does support unions (to a degree, and probably by accident), but there's no way of generating them. (The system modules were "hacked", with Wouter's blessing...) For the particular union you quoted, the different possibilities are all single 32-bit quantities (either pointers or LONG), so you could just pick one for the OBJECT and #define the other element names to refer to that one. That's about the least horrid thing you can do, but it's still horrid. > What is "1<<14L" equal to? Shl(1,14) Cheers! - -- Your numbers are 50, 5, 4, 1, 2 and 2. The target is 971. The conundrum for today is "oeagapptr" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID14_3 "Problems with c->e converting (ID14_3)" From: tommy@pitea.mail.telia.com (Tommy Lindgren) Date: Sat, 14 Nov 1998 03:28:37 +0200 Subject: Re: Problems with c->e converting Hello Stuart Thanks for your answer!!! On 10-Nov-98, you wrote: [snip] > Another great thing! E relies on function calls to do basic math, and t= herefore > prevents you from using particular kinds of calculated constant values.= > (Mostly numbers with shifts and negations.) Also SET does not allow you= to > write 'SET FOURTEEN=3D14' like ENUM allows you. Hmm... ENUMs.. Is it possible to make the ENUM to count down? Something like this: ENUM ZERO,MINUS_ONE,MINUS_TWO... - -- = Tommy Lindgren - tomyl@telia.com http://w1.911.telia.com/~u91103938 = ICQ UIN: 13659426 = Murphy's Law No. 32: Build a system that even a fool can use, and only a fool will use. @endnode @node ID14_4 "Problems with c->e converting (ID14_4)" From: tommy@pitea.mail.telia.com (Tommy Lindgren) Date: Sat, 14 Nov 1998 03:28:55 +0200 Subject: Re: Problems with c->e converting Hello Jason Thanks for your answer!!! On 11-Nov-98, you wrote: [snip] > But, for converting someone else's C datatype, you really want to keep > the same single type (so that translating C code that uses it is a > little easier). Most importantly, the AmigaOS system modules needed to > do this. The E module format does support unions (to a degree, and > probably by accident), but there's no way of generating them. (The > system modules were "hacked", with Wouter's blessing...) How do I "hack" the module? (I guess that it has something to do with a hex-editor :-) - -- Tommy Lindgren - tomyl@telia.com http://w1.911.telia.com/~u91103938 ICQ UIN: 13659426 Murphy's Law No. 32: Build a system that even a fool can use, and only a fool will use. @endnode @node ID14_5 "Problems with c->e converting (ID14_5)" Date: Sat, 14 Nov 1998 16:07:04 +0100 (MET) From: szczepan@student.man.bialystok.pl ("Marcin Juszkiewicz (Szczepan/BlaBla)") Subject: Re: Problems with c->e converting On Sat, 14 Nov 1998, Tommy Lindgren wrote: - ->Hmm... ENUMs.. Is it possible to make the ENUM to count down? - -> - ->Something like this: - -> ENUM ZERO,MINUS_ONE,MINUS_TWO... You can (?) use : ENUM MINUS_TWO = -2,MINUS_ONE,ZERO,ONE - ------ Marcin Juszkiewicz (Szczepan/BlaBla) *Team Amiga* szczepan@student.man.bialystok.pl http://student.man.bialystok.pl/szczepan/ A1200 BlizzIv 2+8MB RAM 425MB HDD x8 CD Author of MultiView for OS 2.0+ -> Aminet:util/sys/2b_mv_os2_x.lha @endnode @node ID14_6 "Problems with c->e converting (ID14_6)" From: tommy@pitea.mail.telia.com (Tommy Lindgren) Date: Sun, 15 Nov 1998 16:09:12 +0200 Subject: Re: Problems with c->e converting Hello Marcin On 14-Nov-98, you wrote: > On Sat, 14 Nov 1998, Tommy Lindgren wrote: > ->Hmm... ENUMs.. Is it possible to make the ENUM to count down? > -> > ->Something like this: > -> ENUM ZERO,MINUS_ONE,MINUS_TWO... > You can (?) use : > ENUM MINUS_TWO = -2,MINUS_ONE,ZERO,ONE That was clever! (or to simple for me 8-) /But/, it didn't work. Actually I don't understand why the compiler doesn't allow it. - -- Tommy Lindgren - tomyl@telia.com http://w1.911.telia.com/~u91103938 ICQ UIN: 13659426 Murphy's Laws of Combat - No. 8 Teamwork is essential, it gives them someone else to shoot at. @endnode @node ID14_7 "Problems with c->e converting (ID14_7)" From: jason@fsel.com ("Jason Hulance") Subject: RE: Problems with c->e converting Date: Mon, 16 Nov 1998 09:37:39 -0000 Tommy Lindgren quoted and wrote: > > The E module format does support unions (to a degree, and > > probably by accident), but there's no way of generating them. (The > > system modules were "hacked", with Wouter's blessing...) > > How do I "hack" the module? (I guess that it has something to > do with a hex-editor :-) Err... no, it's more complicated than that. I can't actually tell you how to do it. Quite reasonably, Wouter wants to keep control of the module format, which he can't do if he releases the format and allows people to write millions of tools that depend on it. So, if you really, really want to do something like this, ask Wouter. Cheers! - -- Your numbers are 5, 5, 7, 7, 8 and 1. The target is 917. The conundrum for today is "umimtluat" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID15_0 "GACT_IMMEDIATE buttons in EasyGUI? (ID15_0)" From: tommy@pitea.mail.telia.com (Tommy Lindgren) Date: Mon, 09 Nov 1998 18:42:07 +0200 Subject: GACT_IMMEDIATE buttons in EasyGUI? Hi! I need buttons with the GACT_IMMEDIATE gadget activate flag. Is this possible to get with EasyGUI without write a new plugin? - -- Tommy Lindgren - tomyl@telia.com http://w1.911.telia.com/~u91103938 ICQ UIN: 13659426 Happiness can't buy money. @endnode @node ID16_0 "Lacking features (was Problems with c->e converting) (ID16_0)" Date: Wed, 11 Nov 1998 09:31:16 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Lacking features (was Problems with c->e converting) > E does not (and probably never will) allow you useful things like unions. [...] > Unfortunately, this means all the unioned identifiers have to have the same > type. What a great language feature! [...] > Another great thing! E relies on function calls to do basic math, and therefore > prevents you from using particular kinds of calculated constant values. > (Mostly numbers with shifts and negations.) Also SET does not allow you to > write 'SET FOURTEEN=14' like ENUM allows you. Yes, you are right. AmigaE has some missing features that may be somewhat useful. But surely it is not the missing of unions and << or >> operators. More generally, it would be better having the chance to declare constants values using any mathematic operator or function call. I don't see the importance of unions. You can surely write a program that is able to not use them and have the same features and not different overhead for that. AmigaE is as good as we know it because it has a much simpler syntax than C or C++. If you really want all C/C++ features you can use them, provided you can stand C/C++ horrible syntax and precedence conventions. One of the most important thing that I think E lacks is a more sophisticated implementation of OOP. We cannot define private methods, and also private objects have severe limitations on how they can be defined. We cannot have polimorphism (or that features that lets you call the same method in different ways to perform different task) and, probably more important, we cannot do any over definition (sorry I just have a lapsus and cannot remember the right term here) of operators for different classes. I don't know if they are ever going to be added to the language, or if the language will be ever update sometime to support other features like direct FPU support, or 20/040/060 optimization and PPC assembly support. The fact that it is a simple language that is more powerful and simple than C but worse (even though always much simpler) than C++ makes it a very good language IMHO. Otheriwise I would have already switched to SAS/C that is now sold for $10. M&F @endnode @node ID16_1 "Lacking features (was Problems with c->e converting) (ID16_1)" Date: Thu, 12 Nov 1998 16:52:42 +0100 From: verhaegs@imec.be (Staf Verhaegen) Subject: Re: Lacking features (was Problems with c->e converting) mauro fontana wrote: > One of the most important thing that I think E lacks is a more > sophisticated implementation of OOP. We cannot define private methods, and > also private objects have severe limitations on how they can be defined. > We cannot have polimorphism (or that features that lets you call the same > method in different ways to perform different task) and, probably more > important, we cannot do any over definition (sorry I just have a lapsus > and cannot remember the right term here) of operators for different > classes. These 'missing' features are caused because E is basically a typeless language. So the compiler doesn't know the type of the arguments for a function so it can only overload the meaning of a member by the number of arguments given to that function. The same goes for operators: the compiler doesn't know the type of the left and the right side argument of an operator so it cannot overload the meaning of an operator. > > M&F greets, Staf. +----------------------------------------+-----------------------------+ |Staf Verhaegen (staf.verhaegen@imec.be) |ADRESS: IMEC vzw. - ASP/TCAD | |tel: 016/ 281 238 | Kapeldreef 75 | |fax: 016/ 281 214 | 3001 Leuven (Belgium)| +----------------------------------------+-----------------------------+ For every tool there are at least 2 uses: the one it was designed for and the other for which it wasn't. @endnode @node ID16_2 "Lacking features (was Problems with c->e converting) (ID16_2)" Date: Fri, 13 Nov 1998 16:18:27 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Lacking features (was Problems with c->e converting) On Thu, 12 Nov 1998, Staf Verhaegen wrote: > mauro fontana wrote: > > One of the most important thing that I think E lacks is a more > > sophisticated implementation of OOP. We cannot define private methods, and > > also private objects have severe limitations on how they can be defined. > > We cannot have polimorphism (or that features that lets you call the same > > method in different ways to perform different task) and, probably more > > important, we cannot do any over definition (sorry I just have a lapsus > > and cannot remember the right term here) of operators for different > > classes. > > These 'missing' features are caused because E is basically a typeless language. > So the compiler doesn't know the type of the arguments for a function so it can > only overload the meaning of a member by the number of arguments given to that > function. The same goes for operators: the compiler doesn't know the type of the > left and the right side argument of an operator so it cannot overload the > meaning of an operator. This may be right for operator overloading, but parameters in functions can be defined as PTR to something, so I think something can be done. The hiding features can still be improved a lot. I hope Wouter will upgade AmigaE some day to support this and new features (like FPU and PPC direct suport). M&F @endnode @node ID16_3 "Lacking features (was Problems with c->e converting) (ID16_3)" Date: Fri, 13 Nov 1998 12:10:17 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Lacking features (was Problems with c->e converting) mauro fontana wrote: > This may be right for operator overloading, but parameters in functions > can be defined as PTR to something, so I think something can be done. > > The hiding features can still be improved a lot. I hope Wouter will upgade > AmigaE some day to support this and new features (like FPU and PPC direct > suport). Isn't someone working on another E compiler... And I have talked to wouter (face to face) this summer at Internatioanl Amiga and had asked him a question like that ... he had simply said that he did not oppose a port of AmigaE to Os 4.0-5.0... ;) I guess it depends on his avalable time or the search for a valid person which would handle such a task... - -MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID17_0 "Problems with c--e converting (ID17_0)" From: frosetti@hotmail.com ("Dennis Andersson") Subject: Re: Problems with c--e converting Date: Wed, 11 Nov 1998 02:31:41 PST > >=>What is "1<<14L" equal to? > >Shl(1,14) or, if we defined the below, it would be the const FOURTEEN. > >SET ZERO, ONE, TWO, THREE, FOUR, FIVE, SIX, SEVEN, EIGHT, NINE, TEN, ELEVEN, >TWELVE, THIRTEEN, FOURTEEN > Did you mean that Shl(1,14)=14, coz' I get 16384. Happy coding! Dennis ______________________________________________________ Get Your Private, Free Email at http://www.hotmail.com @endnode @node ID17_1 "Problems with c--e converting (ID17_1)" Date: Wed, 11 Nov 1998 10:36:39 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Problems with c--e converting On Wed, 11 Nov 1998, Dennis Andersson wrote: =>Did you mean that Shl(1,14)=14, coz' I get 16384. No, I mean that defining SET ZERO, ONE,.... FOURTEEN gives FOURTEEN = Shl(1,14) Stuart @endnode @node ID18_0 "MUI-BodyChunk Objects (ID18_0)" Date: Wed, 11 Nov 1998 02:56:29 -0800 (PST) From: digitaldave98@yahoo.com (David Arbuthnot) Subject: MUI-BodyChunk Objects Hi Everyone What on earth are MUI-BodyChunk Objects for as all i seem to be able to do is put the image on the screen i use bigbrush2e to create the images but could i use them buttons and the like ???? == < Digital Dave 98 > (Or For those of you that read in Hex) $60326873717384657632686586693257563262 E + MUI = Easier GUI coding _________________________________________________________ DO YOU YAHOO!? Get your free @yahoo.com address at http://mail.yahoo.com @endnode @node ID18_1 "MUI-BodyChunk Objects (ID18_1)" Date: Wed, 11 Nov 1998 13:35:50 +0100 From: ss37@irz301.inf.tu-dresden.de (Sven Steiniger) Subject: Re: MUI-BodyChunk Objects Just remember: Buttons are normal TextObjects with some tags of Area-class set. Take a look at libraries/mui.e, especially on the macros for creating buttons (KeyButton() etc.). You could replace the TextObject by BodychunkObject and add the related datas to get your image-button. - -- Sven Steiniger (ss37@inf.tu-dresden.de - http://www.inf.tu-dresden.de/~ss37) And always remember: Heaven is not a place, it's a feeling. (..."Happiness is not a state; it's a process.", Ali Graham) @endnode @node ID19_0 "3D scrolling gadget knob (ID19_0)" Date: Wed, 11 Nov 1998 13:53:56 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: 3D scrolling gadget knob I have tried all ways to obtain a 3D knob for a scrolling BOOPSI gadget placed into a window. But all I obtain is a flat knob. The only way to have a 3D knob was to put the scrolling gadget into the border or adding a frameiclass as the image of the BOOSPI scrolling gadget. This last way, however, the knob is no more autosizing, but it has a fixed size. It is no more proportional to the values of top, visible and maximum inserted in the scrolling gadget. I have used all the ways I know to obtain a 3D knob. I have set the NEWLOOK tag and played with the dri pens but nothing useful has happened. Any one can help me? Thanks M&F @endnode @node ID20_0 "Debugging help for ARexxComm needed! (ID20_0)" From: Chris.S.Handley@btinternet.com ("Chris S Handley") Date: 11 Nov 98 23:47:02 +0000 Subject: Debugging help for ARexxComm needed! Very soon after my posting a while ago about my having finished ARexxComm (a module to make Rexx ports dead easy), to my extreme embarrasement I discovered that it could freeze my Miggy :-( The bug has been introduced after I did a major rework of the code to make it easier, cleaner, etc - and despite hours of looking at the code I cannot guess why it freezes. Enforcer does not work on my miggy, but I just tried CyberGuard & this did not show anything :( . As I do not fully understand the subtleties of Rexx comm ports (I was reworking someone else's 'poor' code), I am a bit stuck since I think the problem may be related to that, rather than a simple programming error. If anyone who knows about using Rexx comm ports could look at my code for anything obviously wrong I would be VERY pleased - and they would get FULL credit in the docs whenever I get round to uploading this thing to the Aminet. Fraid I can't think of any better incentive! Many thanks in advance to anyone offering their help. :-) Please email me DIRECT so as not to fill-up the list even more! PS.I am writing an OOP string class to make string handling bullet proof (which is going brilliantly so far). Has this been done before? - -- Chris S Handley, BEng(Hons) - an overworked PowerAmiga nut & Anime fan EMAIL: Chris.S.Handley@btinternet.com - ---------------------------------------------------------------------- One proud owner of a Risc 240MHz PowerPC 603e, 66MHz bus, 32Mb 60ns RAM, DMA Fast SCSI-II (10Mb/s), Gbs of HD, SyQuest 230Mb removable drive, CD drive, Multi-Sync monitor... all attached to an *AMIGA* :-) @endnode @node ID21_0 "UU encoding (ID21_0)" Date: Fri, 13 Nov 1998 09:30:12 +0100 From: raptor@cs.tu-berlin.de (Gul Dukat) Subject: UU encoding Hi, I've got objects to do uu-encoding and base64 encoding. I will send them via this mailing-list next monday. Sorry, but I'm only connected to the internet via my university 8( @endnode @node ID22_0 "HELP HELP HELP (ID22_0)" Date: Fri, 13 Nov 1998 09:18:04 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: HELP HELP HELP I am trying to build a system where a directory contains any number of Libraries. When the application starts, it opens up each of these libraies and then it can be using any one of them depending on the data being processed. This is in essence a bit the same thing as the Devices or Datatypes idea but applied differently. Yesterday I was implementing this and everything is fine until I try to use one of the functions... in the library(s). my idea was to set the libbase to whatever library I had opened and then when calling up the function it would call the function of that library. but now its crashing, exactly like if I had not opened the library before calling a function... All the libraries are supposed to have the Exact Same definition... the use of these libraries is for a plugin system... This question is a toughy and I guess not many people will have tried this out but I 'm asking anyways... If you have a clue (even if you have not tried it out) PLEASE give it to me... - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID22_1 "HELP HELP HELP (ID22_1)" Date: Fri, 13 Nov 1998 15:32:02 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: HELP HELP HELP > All the libraries are supposed to have the Exact Same definition... > > This question is a toughy and I guess not many people will have tried > this out but I 'm asking anyways... If you have a clue (even if you have > not tried it out) PLEASE give it to me... Right. It is quite tough and I have never tried it. However the first thing that comes to mind is: are all libraries referred with the same libbase variable? Are you opening a library and then trying to open another one wiht the same variable before closing the old one? That is are you sure that OpenLibrary is going to set libbase the right way if a library with the same name is already in memory? Maybe I have not understood what you are trying to do (so trash all I have said here). If so, may you give me more info? M&F @endnode @node ID22_2 "HELP HELP HELP (ID22_2)" Date: Fri, 13 Nov 1998 11:02:08 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: HELP HELP HELP mauro fontana wrote: > > > All the libraries are supposed to have the Exact Same definition... > > > > This question is a toughy and I guess not many people will have tried > > this out but I 'm asking anyways... If you have a clue (even if you have > > not tried it out) PLEASE give it to me... > > Right. It is quite tough and I have never tried it. However the first > thing that comes to mind is: are all libraries referred with the same > libbase variable? Are you opening a library and then trying to open > another one wiht the same variable before closing the old one? That is are > you sure that OpenLibrary is going to set libbase the right way if a > library with the same name is already in memory? > > Maybe I have not understood what you are trying to do (so trash all I have > said here). If so, may you give me more info? > actually the libraries have different names and libbase names... but I am only loading the MODULE for the Defs of the generic Library (which acts like a Base Class) and then storing the opened lib base pointers returned by OpenLibrary into an Array. when it comes time to use the various libraries (I simply set the LibBase of the Generic Library as anyone of those theoretically identical subclassed libraries and Call the Function.. But that does not work. Shoudn't it? I have defined all libs the same way, I am opening the libs within this task, and simply using my generic lib as a switcher for which library to use... since their definition is the same should it not simply jump to the same LVO, but with a different library? If I create different libraries with the same libbase name and Just rename the library within AmigaDos afterwards, OpenLibray() fails upon opening the second library. interesting Note: When the system crashes (I have MCP INstalled and it interrupts the various Alerts) it tells me that an error was created by the EXEC.Library !!! strange... It is the first I build a library within E, is it possible that It has problems accomplishing this task transparently? - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID22_3 "HELP HELP HELP (ID22_3)" From: narg@polbox.com (Piotr Gapinski) Date: Fri, 13 Nov 1998 22:13:29 +0100 Subject: Re: HELP HELP HELP Hello Dnia 13-Lis-98, Maxim Olivier-Adlhoch napisa=EE(a): >to use one of the functions... in the library(s). my idea was to >set the libbase to whatever library I had opened and then when calling >up the function it would call the function of that library. but now >its crashing, exactly like if I had not opened the library before >calling a function... >All the libraries are supposed to have the Exact Same definition... but if they are amigae libraries - you must specify right base for library (library base may have static data); better implement this: 1. each library have one function that return initialized structure like this OBJECT data OF ln hook: hook base: LONG bla: LONG ENDOBJECT 2. internal (library) functions are avialable via CallHookPkt(data.hook,a,b,c) 3. at start ... DEF data:PTR TO data,list:PTR TO mlh base:=3DOpenLibrary("my.library",0) MOVE.L base,A6 JSR -30(A6) MOVE.L D0,data data.base:=3Dbase AddTail(list,data) ... 4. at exit ... base:=3Ddata.base CloseLibrary(base) Remove(data) ... = - -- = Piotr Gapinski mailto:narg@polbox.com | http://free.polbox.pl/n/narg @endnode @node ID22_4 "HELP HELP HELP (ID22_4)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Fri, 13 Nov 1998 22:06:36 +0100 Subject: Re: HELP HELP HELP Den 13-Nov-98, skrev Maxim Olivier-Adlhoch: >I am trying to build a system where a directory contains any number >of Libraries. When the application starts, it opens up each of these >libraies and then it can be using any one of them depending on the data >being processed. > This is in essence a bit the same thing as the Devices or Datatypes >idea but applied differently. > Yesterday I was implementing this and everything is fine until I try >to use one of the functions... in the library(s). my idea was to set >the libbase to whatever library I had opened and then when calling up >the function it would call the function of that library. but now its >crashing, exactly like if I had not opened the library before calling a >function... >All the libraries are supposed to have the Exact Same definition... >the use of these libraries is for a plugin system... >This question is a toughy and I guess not many people will have tried >this out but I 'm asking anyways... If you have a clue (even if you have >not tried it out) PLEASE give it to me... I have written a BBS-system where almost everything is in a different library. I think I ended up doing something like this: MOVEA.L libbase,A6 MOVE.L arguments,D0 JSR -30(A6) MOVE.L D0,result_var But this was mostly because the same code could be called by several tasks simultaniously, I think just using the librarybase variabel normally works.. Maybe you got the name of it wrong somehow? But try that if you think everything else is rigth, it migth work. =) @endnode @node ID22_5 "HELP HELP HELP (ID22_5)" Date: Fri, 13 Nov 1998 17:39:18 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: HELP HELP HELP Hi Carl, You wrote: > I have written a BBS-system where almost everything is in a different library. > I think I ended up doing something like this: > MOVEA.L libbase,A6 > MOVE.L arguments,D0 > JSR -30(A6) > MOVE.L D0,result_var > > But this was mostly because the same code could be called by several tasks > simultaniously, I think just using the librarybase variabel normally works.. > Maybe you got the name of it wrong somehow? But try that if you think > everything else is rigth, it migth work. =) What are the following offsets for each function call? - -15 - -45 - -60 ... ??? look at the following code: its syntax will be wrong, but just consider the alogrythm... remember that both library Templates are the same... ... DEF mylib_base /* let's say that this is the actual ** libbase name of the generic lib. ** IT IS DEFINED in mylib_.m */ DEF lib_array[2}:PTR TO LONG mylib_base := OpenLibrary('mylib_.library', 0) lib_array[0] := mylib_base mylib_base := OpenLibrary('mysecondlib_.library', 0) /* this library's actual ** lib base name is ** mysecondlib_base */ lib_array[1] := mylib_base DebugFunc('test') /* we SHOULD be calling DebungFunc() from ** mysecondlib_.library */ mylib_base := lib_array[0] DebugFunc('test') /* we SHOULD be calling DebungFunc() from ** mylib_.library */ CloseLibrary(lib_array[0]) CloseLibrary(lib_array[1]) ... Can anyone tell me why this would not work... It is Theoretically the same as the assembly sample shown above except that its being done in E syntax no? - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID22_6 "HELP HELP HELP (ID22_6)" Date: Fri, 13 Nov 1998 17:49:11 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: HELP HELP HELP Piotr Gapinski wrote: > > Hello > > Dnia 13-Lis-98, Maxim Olivier-Adlhoch napisan(a): > > >to use one of the functions... in the library(s). my idea was to > >set the libbase to whatever library I had opened and then when > calling > >up the function it would call the function of that library. but > now > >its crashing, exactly like if I had not opened the library before > >calling a function... > >All the libraries are supposed to have the Exact Same definition... > > but if they are amigae libraries - you must specify right base for > library (library base may have static data); better implement this: > 1. each library have one function that return initialized structure > like this > OBJECT data OF ln > hook: hook > base: LONG > bla: LONG > ENDOBJECT > 2. internal (library) functions are avialable via > CallHookPkt(data.hook,a,b,c) VERY clever! in other words, this function allocates an Instances of your 'object' to use. you do not even have to set the lib_Base before calling your function because the hook is an ABSOLUTE pointer, RIGHT? > 3. at start > ... > DEF data:PTR TO data,list:PTR TO mlh > base:=OpenLibrary("my.library",0) > MOVE.L base,A6 > JSR -30(A6) > MOVE.L D0,data > data.base:=base > AddTail(list,data) I Imagine the FIRST function is the one returning the data... ;) > ... > 4. at exit > ... > base:=data.base > CloseLibrary(base) > Remove(data) > ... The only problem here is that this becomes quite a job to handle if the object instance uses many different Methods, NO? Altough I guess I can use the first function as an entrypoint into a SELECT statement which then calls the function of the library I want... - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID22_7 "HELP HELP HELP (ID22_7)" From: narg@polbox.com (Piotr Gapinski) Date: Sat, 14 Nov 1998 10:31:33 +0100 Subject: Re: HELP HELP HELP Hello Dnia 13-Lis-98, Maxim Olivier-Adlhoch napisa=EE(a): >VERY clever! in other words, this function allocates an Instances = >of your 'object' to use. Yes >you do not even have to set the lib_Base before calling >your function because the hook is an ABSOLUTE pointer, RIGHT? Yes, 'hook' and 'data' are allocated by the library function so they are diffrent for each library. You do not need to set up library base before calling CallHookPkt() but you must preserve it, so at exit of your program library could be closed. >I Imagine the FIRST function is the one returning the data... ;) Uhm, but this is only an example :) >The only problem here is that this becomes quite a job to handle if >the object instance uses many different Methods, NO? Yes, this might be a problem but - I've created this for my program (hard/misc/atc.lha) and it work ok (for me :). If yoou want source - please download archive (source included). AFAIK - the same method of calling functions is utilied in BOOPSI system please forgive me my poor English... - -- = Piotr Gapinski mailto:narg@polbox.com | http://free.polbox.pl/n/narg @endnode @node ID22_8 "HELP HELP HELP (ID22_8)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Sat, 14 Nov 1998 15:14:19 +0100 Subject: Re: HELP HELP HELP Den 13-Nov-98, skrev Maxim Olivier-Adlhoch: >What are the following offsets for each function call? >-15 >-45 >-60 >... >??? The first function is -30, the next -36, then -42, -48, -54, -60 and so on. >look at the following code: its syntax will be wrong, but just consider the >alogrythm... >remember that both library Templates are the same... >... >DEF mylib_base /* let's say that this is the actual > ** libbase name of the generic lib. > ** IT IS DEFINED in mylib_.m > */ >DEF lib_array[2}:PTR TO LONG >mylib_base := OpenLibrary('mylib_.library', 0) >lib_array[0] := mylib_base >mylib_base := OpenLibrary('mysecondlib_.library', 0) /* this library's actual > ** lib base name is > ** mysecondlib_base */ >lib_array[1] := mylib_base >DebugFunc('test') /* we SHOULD be calling DebungFunc() from > ** mysecondlib_.library */ >mylib_base := lib_array[0] >DebugFunc('test') /* we SHOULD be calling DebungFunc() from > ** mylib_.library */ >CloseLibrary(lib_array[0]) >CloseLibrary(lib_array[1]) >... >Can anyone tell me why this would not work... It is Theoretically the same >as the assembly sample shown above except that its being done in E syntax no? No. You have DEFed mylib_base, and it is local to your PROC. The actual librarycall will use the variable globally defined by the module. So just skip the DEF mylib_base line and it is correct. Except of course you have to errorcheck so you really succeded in opening the libs. @endnode @node ID22_9 "HELP HELP HELP (ID22_9)" From: jason@fsel.com ("Jason Hulance") Subject: RE: HELP HELP HELP Date: Mon, 16 Nov 1998 09:37:40 -0000 Maxim Olivier-Adlhoch wrote: > look at the following code: its syntax will be wrong, but just > consider the alogrythm... > remember that both library Templates are the same... > > ... > DEF mylib_base /* let's say that this is the actual > ** libbase name of the generic lib. > ** IT IS DEFINED in mylib_.m > */ > DEF lib_array[2}:PTR TO LONG > > mylib_base := OpenLibrary('mylib_.library', 0) > lib_array[0] := mylib_base > mylib_base := OpenLibrary('mysecondlib_.library', 0) > /* this library's actual lib base name is mysecondlib_base */ > > lib_array[1] := mylib_base > DebugFunc('test') > /* we SHOULD be calling DebungFunc() from mysecondlib_.library */ > > mylib_base := lib_array[0] > DebugFunc('test') > /* we SHOULD be calling DebungFunc() from mylib_.library */ > > CloseLibrary(lib_array[0]) > CloseLibrary(lib_array[1]) > ... > > Can anyone tell me why this would not work... It is Theoretically > the same as the assembly sample shown above except that its being done in > E syntax no? If the library structure are truly identical (look at the .fd files?) then I can imagine that the problem lies in the library base variables. I suspect that the code in the library uses its library base variable to call its own functions, and of course you've not set up mysecondlib_base. You could try setting all of the library base variables to the opened library. This ought to prove the point, or refute it. If this is the problem, then your program needs to consider the base variable as part of the identification of a library (where you use only the string for the library name at the moment). When you go to open the specific library you want (based on specific string), that code should also set the specific library base variable. Cheers! - -- Your numbers are 5, 5, 7, 7, 8 and 1. The target is 917. The conundrum for today is "umimtluat" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID22_10 "HELP HELP HELP (ID22_10)" Date: Mon, 16 Nov 1998 09:17:09 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: HELP HELP HELP Carl Drougge wrote: > No. You have DEFed mylib_base, and it is local to your PROC. The actual > librarycall will use the variable globally defined by the module. So just skip > the DEF mylib_base line and it is correct. Except of course you have to > errorcheck so you really succeded in opening the libs. sorry I should have noted that It was defined in the Module... I knew about tht one.. but thanks, I have now erased my application code, redone it and also taken care that all libraries were at the good version and now everything is working smoothly with a more advanced system similar to the above... thanks for your help, ALL of you. - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID22_11 "HELP HELP HELP (ID22_11)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Mon, 16 Nov 1998 21:11:35 +0100 Subject: RE: HELP HELP HELP Den 16-Nov-98, skrev Jason Hulance: >If the library structure are truly identical (look at the .fd files?) then >I can imagine that the problem lies in the library base variables. I >suspect that the code in the library uses its library base variable to >call its own functions, and of course you've not set up mysecondlib_base. >You could try setting all of the library base variables to the opened >library. This ought to prove the point, or refute it. >If this is the problem, then your program needs to consider the base >variable as part of the identification of a library (where you use only >the string for the library name at the moment). When you go to open the >specific library you want (based on specific string), that code should >also set the specific library base variable. No, when E calls a library, it will allways but the #?base in A6, as is also the rule that you must. Most libraries rely on this. *No* library knows about E's global variables, so where it went from to A6 is not important. @endnode @node ID22_12 "HELP HELP HELP (ID22_12)" From: jason@fsel.com ("Jason Hulance") Subject: RE: HELP HELP HELP Date: Tue, 17 Nov 1998 09:00:43 -0000 Carl Drougge wrote: > No, when E calls a library, it will allways but the #?base in A6, > as is also the rule that you must. Most libraries rely on this. *No* > library knows about E's global variables, so where it went from to A6 > is not important. Ah, yes, you're right. Silly me. What's Maxim's problem, then? Cheers! - -- Your numbers are 3, 3, 10, 5, 4 and 5. The target is 534. The conundrum for today is "tnbaotmca" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID23_0 "(no subject) (ID23_0)" From: dave@shaye.demon.co.uk ("Dave Denton") Date: 13 Nov 98 21:52:10 +0000 Subject: (no subject) HELP I am trying to create a progrma that acts on a window activation and I can't seem to get the following piece of code to work. SELECT msgtype CASE CXM_IEVENT IF ievent.class=IECLASS_RAWKEY buff:=New(100) num:=MapRawKey(ievent,buff,100,0) IF num=1 Write('key:=\s\n',buff) -> Works ENDIF IF ievent.class=IECLASS_CHANGEWINDOW WriteF('IECLASS_CHANGEWINDOW\n') -> does'nt ENDIF IF ievent.class=IECLASS_INACTIVEWINDOW WriteF('IECLASS_INACTIVEWINDOW\n') -> does'nt ENDIF IF ievent.class=IECLASS_ACTIVEWINDOW WriteF('IECLASS_ACTIVEWINDOW\n') -> does'nt ENDIF IF ievent.class=IECLASS_CLOSEWINDOW WriteF('IECLASS_CLOSEWINDOW\n') -> does'nt ENDIF IF ievent.code=IECODE_MBUTTON WriteF('Middle Mouse\n') -> Works ENDIF The code is not notifying me when a window is activated. Can anyone help? This is my first request for help using this list so I am not sure if I have to include my email address so here it is anyway. Kind regards Dave Denton. dave@shaye.demon.co.uk @endnode @node ID24_0 "IECLASS_ACTIVEWINDOW (ID24_0)" From: dave@shaye.demon.co.uk ("Dave Denton") Date: 13 Nov 98 22:20:19 +0000 Subject: IECLASS_ACTIVEWINDOW HELP I am trying to create a progrma that acts on a window activation and I can't seem to get the following piece of code to work. SELECT msgtype CASE CXM_IEVENT IF ievent.class=IECLASS_RAWKEY buff:=New(100) num:=MapRawKey(ievent,buff,100,0) IF num=1 Write('key:=\s\n',buff) -> Works ENDIF IF ievent.class=IECLASS_CHANGEWINDOW WriteF('IECLASS_CHANGEWINDOW\n') -> does'nt ENDIF IF ievent.class=IECLASS_INACTIVEWINDOW WriteF('IECLASS_INACTIVEWINDOW\n') -> does'nt ENDIF IF ievent.class=IECLASS_ACTIVEWINDOW WriteF('IECLASS_ACTIVEWINDOW\n') -> does'nt ENDIF IF ievent.class=IECLASS_CLOSEWINDOW WriteF('IECLASS_CLOSEWINDOW\n') -> does'nt ENDIF IF ievent.code=IECODE_MBUTTON WriteF('Middle Mouse\n') -> Works ENDIF The code is not notifying me when a window is activated. Can anyone help? This is my first request for help using this list so I am not sure if I have to include my email address so here it is anyway. Kind regards Dave Denton. dave@shaye.demon.co.uk @endnode @node ID24_1 "IECLASS_ACTIVEWINDOW (ID24_1)" Date: 13 Nov 98 22:49:40 -0500 From: victord@netrover.com ("Victor Ducedre") Subject: Re: IECLASS_ACTIVEWINDOW >HELP >I am trying to create a progrma that acts on a window activation and I >can't seem to get the following piece of code to work. >SELECT msgtype > CASE CXM_IEVENT > IF ievent.class=IECLASS_RAWKEY > buff:=New(100) > num:=MapRawKey(ievent,buff,100,0) > IF num=1 > Write('key:=\s\n',buff) -> Works > ENDIF ENDIF <- you're missing one > IF ievent.class=IECLASS_CHANGEWINDOW > WriteF('IECLASS_CHANGEWINDOW\n') -> does'nt > ENDIF > IF ievent.class=IECLASS_INACTIVEWINDOW > WriteF('IECLASS_INACTIVEWINDOW\n') -> does'nt > ENDIF > IF ievent.class=IECLASS_ACTIVEWINDOW > WriteF('IECLASS_ACTIVEWINDOW\n') -> does'nt > ENDIF > IF ievent.class=IECLASS_CLOSEWINDOW > WriteF('IECLASS_CLOSEWINDOW\n') -> does'nt > ENDIF > IF ievent.code=IECODE_MBUTTON > WriteF('Middle Mouse\n') -> Works > ENDIF >The code is not notifying me when a window is activated. Can anyone help? The missing ENDIF should do it. You might find using another SELECT/CASE block easier, and then test ievent.code separately, or maybe it's just me. :) - -- Victor Ducedre (victord@netrover.com) Team AMIGA Now proud keeper of the XPKatana spell (v 1.4 on its way). "She wore a charcoal-coloured suit to dinner," Tom said ingraciatingly @endnode @node ID24_2 "IECLASS_ACTIVEWINDOW (ID24_2)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Sat, 14 Nov 1998 15:09:22 +0100 Subject: Re: IECLASS_ACTIVEWINDOW Den 13-Nov-98, skrev Dave Denton: [Lots of code cut away here] >The code is not notifying me when a window is activated. Can anyone help? Well, I think you have cut some pieces out, otherwise the last one wouldn't work either (the missing ENDIF, as mentioned in another reply). The first thing that comes to mind is: Have you told intuition that you want to be notified? I don't remember how to do that off the top of my head (I hardly ever use anything but stdio), but I'm sure you know. =) @endnode @node ID24_3 "IECLASS_ACTIVEWINDOW (ID24_3)" From: dave@shaye.demon.co.uk ("Dave Denton") Date: 19 Nov 98 19:47:20 +0000 Subject: Re: IECLASS_ACTIVEWINDOW > > > Oh well, CX* just struck me: You're using commodities.library.. I have no > experience of what that does or not. =) > Here's a working example of doing it with input.device, attached. > > [...] Thanks for the source it's exactly the kind of thing I was looking to do. I just didn't realise it would be that complex since I have no experience in assembler. :) Thanks, Dave Denton @endnode @node ID25_0 "EasyGUI: dynamic definition? (ID25_0)" From: zokie@teseo.it (Francesco De Napoli) Date: Sun, 15 Nov 1998 11:48:05 +0100 Subject: EasyGUI: dynamic definition? Hello boys, I need to do a dynamic definition of EasyGUI list, but I don't know if it is possible, and how do it. Is there someone who has any examples or knows how do it? In the past, I define more than a gui and then change, on the fly, the pointer, but now I must define a gui after reading an external prefs file, and user may change it in random way. Kind regards - -- "When do you want to reboot today?" @endnode @node ID25_1 "EasyGUI: dynamic definition? (ID25_1)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Sun, 15 Nov 1998 15:00:22 +0100 Subject: Re: EasyGUI: dynamic definition? Den 15-Nov-98, skrev Francesco De Napoli: >Hello boys, >I need to do a dynamic definition of EasyGUI list, but I don't >know if it is possible, and how do it. Is there someone who has any >examples or knows how do it? >In the past, I define more than a gui and then change, on the fly, the >pointer, but now I must define a gui after reading an external prefs file, >and user may change it in random way. Dynamic lists as such are not a problem.. I do it lots of times in my nice and pure programs that use *TagList() functions. You just decide how long your list needs to be, and allocate it: DEF list : PTR TO LONG list := New( of_elements * SIZEOF LONG ) And when you need a list in list you just allocate it the same way list[ offset ] := New( of_elements_this_time * SIZEOF LONG ) The only problem I can see is that easygui might rely on the lists being E-lists, but I think there is such a function as NewList() or something (check the guide) that would solve that problem. @endnode @node ID25_2 "EasyGUI: dynamic definition? (ID25_2)" From: jason@fsel.com ("Jason Hulance") Subject: RE: EasyGUI: dynamic definition? Date: Mon, 16 Nov 1998 09:37:38 -0000 Francesco De Napoli wrote: > Hello boys, ...and girls, > I need to do a dynamic definition of EasyGUI list, but I don't > know if it is possible, and how do it. Is there someone who has any > examples or knows how do it? It's very simple. Take a look at: Src/Tools/EasyGUI/Examples/testchange.e Src/Tools/EasyGUI/Examples/testchange2.e Src/Tools/EasyGUI/Examples/tabs_test2.e For a truly dynamic GUI, you'd construct the GUI definitions using dynamically allocated E-lists (i.e., using List()) and fill in the data. Of course, in the most dynamic cases, you'll need to worry about constructing a valid GUI definition. EasyGUI will fail gracefully with most bad definitions, but not all. "Caveat programmer." Cheers! - -- Your numbers are 10, 1, 6, 9, 2 and 6. The target is 646. The conundrum for today is "naimrtieu" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID25_3 "EasyGUI: dynamic definition? (ID25_3)" From: zokie@teseo.it (Francesco De Napoli) Date: Tue, 17 Nov 1998 18:43:37 +0100 Subject: Re: EasyGUI: dynamic definition? Hello Jason On 16-Nov-98, Jason Hulance wrote: > Francesco De Napoli wrote: > >> Hello boys, > > ...and girls, :) > It's very simple. Take a look at: > > Src/Tools/EasyGUI/Examples/testchange.e > Src/Tools/EasyGUI/Examples/testchange2.e > Src/Tools/EasyGUI/Examples/tabs_test2.e I had studied them long time ago, and I had used those solutions for my old guis, but now I need more dynamic definition. I'm writing a kind of database, and users may add or remove archives and/or fields in record, and input form must adapt himself to new record definition. > > For a truly dynamic GUI, you'd construct the GUI definitions using > dynamically allocated E-lists (i.e., using List()) and fill in the This is what I need, and now I'm experimenting :) I hope to meet not very often Mr Guru :) I will thank you and other people who suggest solutions. - -- "When do you want to reboot today?" @endnode @node ID26_0 "Audio Module (ID26_0)" From: sanric@ronet.it (Riccardo Santato) Date: Sat, 14 Nov 1998 13:44:53 +0100 Subject: Audio Module Warning: This is a message in MIME format. Your mail reader does not support MIME. Some parts of this message will be readable as plain text. To see the rest, you will need to upgrade your mail reader. - --BOUNDARY.2015332896.1 Content-Type: text/plain Hello world, After having received the source for audio.device from Rainer Muller I decided to make a module of it, in order to use it at best with AmigaE. It's very simple, it doesn't have lots of features, just one function, but it could be useful for tiny programs. Have fun ! ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== - --BOUNDARY.2015332896.1 Content-Type: application/x-lha; name="sc_sound.lha" Content-Disposition: attachment; filename="sc_sound.lha" Content-Transfer-Encoding: base64 Content-Description: System Compliant Sound Module HNUtbGg1LSEDAADBBgAAW6RtJQAABlJlYWRtZdfLAvhqmtZI4pfT58AfdRb0TDGQERHqBNek 0NDo6k2RVok9uZ7cy+l5d4Xd5uuPxx/9ebJs4FUQaVEQVpHKO7VpN2gv358Xpwtvt/Dbs8Pq 6y6qun4dn+Jov65/M1tyjJLyrffg1hukXbs6/8mi3vgWDTyY60omABI/7NFjFZU8bGPqsTgy tP+mv/df98oHO+5kSvfZi1C4nEq4IcksLfB95GUX4wCmtZwRxSeV6FuyLuNjkgXbi1qQplcg akrhRl+8ts6KdnRRorf+RayciWAPE2tNgIAC7tP2qMusjmTsdFliFflyL41FRscWm8E0gB71 iy0JOnXV1VNuPQW7GRMloiVxws4nAJk3WisPsDPgj+AUOsNN0sz5qHB1HKu+EH2wO8EFtINB EBf423SH/NRcuL8W2Ab4AXQPwycswFOahudJx1Rh34e7soXBc6wuv2vGwU5FItmrVr9uvT7g ksqqNryuQLPiAOCVVVc7FDJh0hWGJe/GMie5C34urkx7i9a1Ezx36C43MruIGEj/EmR+eijn 3fXGRwlTGT8KbDkeEoT/7UdSIGAXlPB7cb06BgLxVFzQlFE5jniTqZAITdkHYHtuQg+LCzHl dWDwf9FReEcTa0XBFsREdNOdoHF+mUGvVqL5tv2fcVZuUPsZv3g9dOMfCwW2E/HxZhOmzHMk w2l16e/SWANKlUT8PQR7HWKifzUYh+T48of61VWY8oznSiotcvJFBAajjLtHgc9Wc6KXeU73 vH2GIrlwlGdHwAvCKb8Wz8DljI+PPAkKvOtnn4e5yJL0qi7wBXMtFfFxxF/aZiu8IPPpTufR Rnajzd/0tfxLIaUlHBD8UhEvUXcl6X7lbvLMC16ctXulXj8vyLdzsOOVIKXaJwf0CnfvfkHb +s8/BBkDnu36ZmIYxykwI0IDPdI89yyMfomBgK+sN6K/GibPVVV3G5yNj7C8UTBa1DXwSjYv 8zNbDTElr1yXnKyFPPe9z5UHubO9djyDRdWWv49k6/DfXImnC0GzGr4Sfvfjoa3PclduH4ZK 1l8Oo+yj01yOkvgdai7qtbPQqgqAICctbGg1LQcGAACwEQAAwIttJQAACnNjX3NvdW5kLmXX RwTmc7vVpt2x8Zv4A/+4QOxyEZZLpC51IzOnoLA2YCWVbTKJjOhGqx9fm2Sw3xx/73vWyQJS 2y26q2rJXg7hZZbbgZbie+B23h2rbbbi9bwD+DDpmnLnBw2eSKF+OcCbt42QMppQs6MkJt7I XqhgKByxcPAH7fkGT0sOaGN+IJjaJRRUBshQx6QwPwxllC9oiiH61mV561y3YfyLkQTwwQPy 5DBhFn35ze1S/yzDXhB03UXPjFfNcfHxfQy/hS/v+rLrvX8SYAkR5E8197BiXXSCWqP54cz8 UOOtCaoyvqVtRMqpqz55cUClqmQ01Yf8QCyScvWWBB4HaeoC5y5zS6diWQIjGWk3rDyGln7g +aV+TphgmrZsvXjfmLUXXI7y3gJg6HXnSMp8Hr5HVeV4l5Xid6FeVx7AT7ledonluOUHF16z aXXcedw4gdxYXOhy6859rfh4fq4+Hg4aWJv2btIng8XFx8K5/1/A84EkT+mZ8a8C1Zp35Z2Z pzSM5H535J5UfcRY2RIZX5ys9RotGcrAcll20MkbRLYPyl/9oLNO1Yv4sAYnghMiOaV5QNr2 NYaUskWlpt25doNc8nYJr+wSKA71FnPI6ksjSEg6YZMejLrUTnJZwaxtf2jcxm99PimkQssp pW2kgjZcsxZ0+c8Ocs1DbTKCQRGg86kRl66E6qfyAy66hbdAU4C5bOD3skMx5JZYn80wDGU8 uwxchHUpiw3TMsCXcJKAuqfikXVpjLYbclKMvL02a+NUFVhg77JSY4dpi1aabmPSeV/6PNVC KjwavkgaqWRZDDc+8j1uiY/uSiK9WEQcreAPQfMgOPB+IXxFKA/HkDRMf70jNB+OMsQeiGfp B6QsdovVVYAcIHZUG1vDnCzx70Ue9JLDYbs2rN0YY9F6z5r+Ajm0qgNnznUgHKnL1roQXWcR NpSiVqyCe49bFuuazcxbCVDbecuk5Lv7BR7ZDhvwaZrs8DPF+Ng9RewjG4TNP0nJeDxqjP2V OWG1PmICrUf7NVY4199nUhx9WNsZ04UaY0QGk0jJlRkjX7kNoxxDqn0ZcpZR1EGkKOA6E0fs jCqGwz8GGXNgue+F4UwvvkweV67sJRUMI7ewOS2oeqqm1YFYiGNhYnEsksT57B8GmCIsyR7R xTgvHeLn1VVM04qNtTi9FzyshgeRsGvF4eLgVldPXlRhuF0Tzn8pYKvE1xiixznW+hzkuX9x Hjf5fsu3HPdXeJCx6knX/+k1JRGK6w2sB4nozzCEOkqFqjGLYbOK3R4RNVON/WRKQaPoN0K9 CbRmETtSsN0xL7Rm8i/s+yKw2nC3QdjTnMUbZ8sMo03z+gyqaKkwZR4h579KOLxWUZUS/Vqn 3E6uqc+uxs05srDZwagWy3w7Z0HW0gTbzrPcZR44dx7VR6x8WW3FaMqdOvtZ1P2G4Hraav6W m9RB9GmpWSdmNMpmlllkZYIZwG9KgLRI8Z1CpzaBlDTH/AS+SziWScaI54YhwRxlZDzlLIGU pckMeZFmGyXqwcwqVGknuoUYEX/0s46ZwD2Cz7/W0Bx9LiLndTgJ45nc61cQp9kXeMOZEdtX LaUais/6/Jvr7vkDmlhnLbq1OccPvOjEDz5OeOozTS5TMcWDRJhhKi+c/aCyifqyuGnslyt2 y4Eaon2USbmoqtEcS3insPg4R7tjnoPwPqp70xdlj/XaOrPW7Rw3vdpOHPf1yszGPmnR5fGi 8f3xoyTN9NWHK7iHI6PHZRfAhU/LN6nI9/eWnvyGtfLIa1+uNk7Msf5jGOffpjG+Ec0j/hHQ 8W0R1J5nCD1rrTytndFLCIKIh1blKUY0rU652NhU18Cppj1cQJvfSVuRGmKniErdzs3OzpWB SnLRYi9vKi2madVi3cYK5iCyeWlX1ljXzLEpnCS6RzEBeuAsh+KVRP+yPPUopQH38YX5YY5x u0dNOBYzaM3SCe0yN3LG01Pzie01cHmMCcQI5xAHlL3myObX+ZtTB3vO08j/tagO3lBBV/4x qNxxC9h06QNbxk6iy6Z+k+jx77aDQaUUwsHudWj9rRcg4i1saDUtWAQAAAQJAADNi20lAAAK c2Nfc291bmQubVbTA3xqgu7Vtqbf/SekZqwrkESqYb7TgSzWWxXgeBESSyQJc2+9G67I4Utm 19axJJPmSTGwIPtxvA8GERM8Lzbg1xOC8CgiTgokEok4IJeCJpwUG8GHXgvBCku+/ffe9ZJV 2C5QXAhuh5EHe6WNtuPSM1iOTwiKOMlKJz9hJ8uyJT81+afXk/pikx3T/bjsHtGLHiHup83E +bCfNdPnbMoPOvDhHqjOsM9iCwerF3nn3QZJ9aDmn7GPNPsH7i04/c9LGL8ZNZ00FSry2tQi w8f4i9XF8o+zohgUa/q+k+zCmn2V+1v6aFry2tMi48npk7X+wM77rHdJXAPueEeG3uLZB7sO ISpo48kgxzO2ooDWiDW3eNVb5qb4w0NuLYR/8uIXGMs3v9OIXINEb1gP6BiRrAVaLvFhLPg3 L4lVHSr5AfkxCgGVc0+jF3nvnGKANtEm2170dELUv2hfvMC/d4Ffx76vh5B9mHkE/SUvwUvn F/ylsi9rhGUc05If3dD+20P6Pdoe33DAV2iAvWB3x34kPEKcTv1Ewx9ciWJBOZ2g7bLRFftb +eied6Gbrvxp/w3r+E3Dn4knprFfdMFOwGTxIZB79i8L8lAuAS2L1uqCGyHP2Oa0grx5x7R9 ob7gffaEa8Nt9y8yxqlyHH7sIfu+z/C/441gKfcQS8Et2yngl2GHthgx+cem8nbGqfccUNf+ 1CBu49aQJDXoU9cJm1+yntOKe1fU4de2faCtuoddbGLDwcvyHD9rxC/lB7tJn7u1dU9sR3ft wnRyjbTKIgjj38H8OfOAPGKB4nT4G53XG53b7c/u9/M1T7AWv3oV6OM5F7daS1JrQyAGy2B5 yQKJu1uqnojz/GyoO+KM9n+WRTSfshhYiaUe3/8VQodtLYqaZd7TCPst0YRyt/3pbekDd8fL NxN9957/KkD/65T/88cHQFbfQFa/QPVyuyfso5XorPil3Xcq3roYFwHYwA9fTbB23KcPsIo+ oJ1rwPfmo7UuA7jgPRRAlwHd4AZnVUL0JHzxVd/CG+EQW6BOiigSI96RneAh+fiIcoyuAh9z iIVjPHCHzQQwPAQmLt3UXHxM+4v7y9RegtLqaUyhk6TPSmdFlbG5MHCKNLnz6FNbo0WZdNlb LYzmfhqM0qfgEGoUQDXABmfQqanvrTmZ1Cj1MIuFIol55AzhtE9uDP5DOsM/M0TyU0Tr5Bma M88ZgNEp1xmeOSH6jP1jPXJUn5psvqUpc401ly+ioT0+uPfKpU5dGnCpU6BoWlLpyzU6Kfc1 mfCBhRDTQulQm1JzJHODUi+hPwDXsjO0F2MxiLHb+A67TvlMZ2e3vdJ35sjNT8D0XxZUXM0I 2YxG9kUd0XyV8/mRuAAkxUSYsSpC6CEieJ3x5HOy40hF0UfkgV5DY9VO0Rbke0l0eMM5RYgi DpVJrNL1pc6ZqS5szoQxEmchkSfdBnUmT8thD+j4cbzWCErDOSG+pjL9uDQafS1saDUtjgkA AKASAAAGjG0lAAAEVGVzdKpfB8dywve6tqObf8slrOjRYpRLuOG/mF16ystlUREROJJK9o0b 6PVtc8nYWW2SMWWT3SyPLh26VcJxwm3cc/Btxxt3wcccdqpdhMbBjFVojkpiCU4pig0zcNxr t1N0HQpLf39/+96SVV4z3cG3Bg4Mb49jb4MG7dbW23HOImfxEv8yKn805QD/uPu65JNLSBbE jdEXl3jjdGS2JKdJO5uZsRorXKTHRTuYPfl9T7jsu3RM9UvNKgAPIc+anG9j9KnS0/12Ty5/ CWJE2L395egPeax357l4nLe6JfgcwE5nE1iLpGqPxU9E/zlROUBfqgDnP9EuCrslOlpZQMZ0 UineADkAD+QAbOmByQB9p08DC449TY3sjv7jmCmjxLfAk4VtHjX0qFK5RRpEuZGlxpMimBiy oSvFjX9QiJT8xFW9I+uttLaOmjc4iZ8WvdR05Lh0mfZspZcg4I/A4aDrlnDGxjpz0Nordxco tB63YD2yG0TQcAzD73w75DHecfeydJy4rY4iuH49+dYuk5qnoLxNYjzw+tB9jGWQ9UpMUvU5 7u1JusyfVg/CTTZvE59bNOYsci2DvdQd9u1KRDruECFqi1Tn76a7IBWqwXnmFBvoKkOs9Vni 9FM/jkW3RalW2NqmejBToa6bZkfu7Iz/gzZwI7Gw6j6kLux78Qk44G6HBmmjXAWtiGzZ/wdL Pan9gC0BgtIteuy5r1v7xtrA7rcoPwhU2qaDt4RqPQHdoarHdqaB3vbLWHF0dza2i4BWwmcs E9ENrnidreByd5qJlZErNm4JFgp9Y4Zmnya+eIBrE8cydUlxaaFNt/46jb0Vm3+WJ+o3dFdu xCVZuya+Ju5zDdhRpo6jd0MXok1irQXKDe3lRvaTKhK4JVrhr2gTqlLbXc3p18Sj+LqcfvUm 1pTNboYwC040ldbu6qJFxgpoWQKwj26yPrTR+LzeM3u5rjsGlX1mlITOeb6uzkeGrWP+gxg9 oLLM1rjwO7YG/f59nBTlrYPaK3Wgt1nLdewt1zlWQ647t0nFHPTHPvDMHivdGr/QM6/Tc3Sf e2YyFjJbgpz7ezL9UDGqjxitLmaIL6zZ8stvYa1OVxCJsfn9/7ycoQ/yhnliU5OifJM6j06g +h8g8NvQYlm0VuDlyZjve2yZA1lA1zKZq01JI+mGhzHs4/2ueF5CqF/faPC8pV4v5gPsVSPz AVApdtkNQ3LUmjKqaNTD7J4ThVox42T3RrPpKkJM5kol2107g4WrP2a/q9Rfs9RXt6ivEpco YA61agTeLSpXX9oi1p+bpVkx42zGLHMYyy5Z4qe/AVmcBfWB23Oia8LBJntVoYjIygjJ1WZn a5aIr9LSvDnnThnVeKNP9zfsfIbhz6+ByUFUdMFOQGTrzpepyKYt0Ys87/rYYIckOfkXp0g8 jZ4KctOaeLMPvmiNesXfcq6d0S8ph+5xv3UZ/vv+MNYCp0DJaUt1ymlLsMPmGwer5zD0006K kNKmH2P7KE6T9ZNMSdTMysJnL8Cny2FPl1FOHXzE5oVtE3XRZlrNTF+R3WfnF88HuatP2eKm eYI71q8JzxRrpk4gjD3xvlc/BAOzJx87p0m5nsNzPqNz4Xv3/RTkBa9c1eta1L6uNAmwMZat jkrgeAsBObuNhrZEeF9DKg78cZ8n5mRWpP5IYV4tSjzv/xVChzl7vMQtOIEfkr0YRit/1ktp yBo/RizYTfieepipA/+uKf/zxueGK2/DFa/hpxX2InEPFedZ8Uu+wxVvUNgWAc7UB48RcHmM U4fMOj6ZOimD0o55qWAdBgHxDgSwDo0gatVihehI+SKrvZdtREFe+X2joEiPeANGLUIeh4yF 8q01CHz/GQoVq2CHYAhcfGQqr6uW4Ez17iMlEKZgRpNtgQ+RGv4aLPZOWxP4UiRJlov5UOFL ho3kG7h+jMh4Uv4xCsmUAagAQ5EmZF4qMGHgyZXKbF30ietRGgJgd1kegNaiT9dbE6+o4Hme ilVIMTNpaC89AeGvt4RFsTa3vhwD9o8ArGg7onfFXve/0vPlEpXnz0a62X+4NBuz2ALLwaj+ irqjlGxcZasWd6K1qvXmer+p40fHhHo04jsaZ9ZV7VVJvWaTRNpeZoFfzHjXU9HzqaceEVVy A8rUa+vNXSL3RquEvME8tsIp/XBbWuXmlRcvdKgBuqXGwiZ5xue90WXVpgfgYA/YpgcdgDuK YH8a4EvipgfbYA9GmB+2wBgO2q1Bt1pUbaaOp6vNoCMSZZirmtQRJ2YcEJ94HJ4DgA3kIu96 oH167y+bGjw0RsJEeTfjCJgIhS0I+nHwED6zu92NPs+3d3uUXV7v7xF9DQ/gbzfAGjZDEvCk YCI0vywdQ5EXiyzQhnLYrT/nzYGaP9/WhmV1BuL3exvrhtb7lIu41/fwpWBJRv4UiXClyfmM oMqNFjSIUdGFJmShlgv5OBDWPYUaRDlIupkeOO3gMv+sw2bG6iN/ysKXDwUP5OCrHjBk0bu1 upOAiJJlIe9/PGtAEsKZJkSbaVC9IpaT1jNk/cOxWldk1sSsixupAf9ccvn87mwHuP1ID58+ ncyy1akwyEym5m8etucPjN7jDhVtxNUmXE0es+4w4D25exEO2cB7t2W2J88gPJvWcFAebWq5 nWt2T57Ae2VgpMgPYHdryl2HILkl3Ob3Jvc6H5cOG0+7h3fN87sjbCtEMxlZrwT93VimITeX psbHnEtiivHBWe6SnToo1rUWuYtVe/ag/zgFY60D/ZdOy5dwt7jMXXDKe2RWBFzlJjjVAf7o yz95VK4GyfhzWh2//T0ONuLIv2+od+UbGNj+BSe8NX/gWxfJQ82j8UDcROfsnxNBmjG6P300 4IqkxBdpFR501/njba66LsLHeOHuLhxJ6HI3ofrsIm2UmW7sqxEkmuLxU0b5ptHidNSY5kk0 FE8Uw4teh4N9Li2kdajXTo3qTkR05yk4b707NfmGrUek1avxmb3eiVoafso6cax1Ys094b9l jcy6fvofXI2j/r9Xf+ohqpM2GMpMGcu0cNfDuLQ589yvsc/cVrjpArq9/BU3Nu72m0d7fbW7 vcW7uDMlqzJZEGxapxFm39v/Db1MG++m+CK+vQ88MUxA3lnt/f8wPUmBxc8SzcL/x+/I64qg docjQB6rnDnYjUUV459sbZb3xz2SKrBPVic9WPes2w5H8HSs+yOfZB/fDBh7g5CHbZw0PLYY YAdsuqOcoiquAOcUcjzZ68cyBz7o5xgmz0o1aOaxdi2f8hzrLWxoNS1CAQAAnQIAAASMbSUA AAZUZXN0LmWbsAFBWpettTvnngD/cUtxXamFeDA8C7Wig12LncdDE1n9mBLJiWVXPjj+YzhB HkeV6UeltgWtpuGozZdPfMBI72tXbh2KWJ5DByR79teq1tzE/LYfUa8Ng2NdvOY2WacC/JFi wxs9ObIFiFMijMbi1x9ThQmA7Ee25rG4HI9DySyUTUT6snb3Zyi87lMfPEeplTL5ING+142B kbZuWpDHhNzUNSGxrg67kqbgSPmqsQhGVMPHyAb4fq+p3M5W1TELAr5cRBW1Ihr3hSVqi4KL lrL19zvDKqvYU8JJVdaHJaGgrAQ9v4d/9c/yhmo/xnqctQgq0FtrQ8rAQ8AqTAoipmLVfZNT jCjTo8Q1iENbEzC9ejqYhiQU+pBTYs2+T4ApTRD0nHgGRNuWjfagtmjFLBl7upMWKXolk6ee M03hlhxAMYAA - --BOUNDARY.2015332896.1-- @endnode @node ID26_1 "Audio Module (ID26_1)" Date: Tue, 17 Nov 1998 10:39:29 +0100 From: Rainer.M.Mueller@uni-konstanz.de (Rainer =?iso-8859-1?Q?M=FCller?=) Subject: Re: Audio Module Hi ! >After having received the source for audio.device from Rainer Muller I decided >to make a module of it, in order to use it at best with AmigaE. >It's very simple, it doesn't have lots of features, just one function, but= it >could be useful for tiny programs. >Have fun ! There is a little mistake in the readme file. It is *wrong* that all four channels are allocated. Only *one* channel is allocated. More detailed: * arequest1.data :=3D[1,2,4,8]:CHAR arequest1.length:=3D4 means that the program tries to allocate channel '1'. If this fails, '2' is tried. If this fails too, then channel '3' is try'ed.... * arequest1.data :=3D[8,2,4,1]:CHAR arequest1.length:=3D4 means that the program tries to allocate channel '4'. If this fails, '2' is tried. If this fails too, then channel '3' is try'ed.... * arequest1.data :=3D[1]:CHAR arequest1.length:=3D1 would be: try to allocate channel '1' if this fails, bad luck :-) * arequest1.data :=3D[15]:CHAR arequest1.length:=3D1 means: allocate ALL channels arequest1.data:=3D[]:CHAR contains bit-masks of the channels which are to be allocated. The first mask is tried first, then the second, etc. 1 and 8 (=3D%0001 and %1000) are on the right 2 and 4 (=3D%0010 and %0100) are on the left. - -> the bit-mask of the first example is [0001,0010,0100,1000] the bit-mask of the last example is [1111]. Hope it's more clear, how the allocation of channels works. Wait, last example: * arequest1.data :=3D[3,5,10,12,1,2,4,8]:CHAR arequest1.length:=3D8 this one tries at first to allocate a stereo channel (=3Done on the left, on= e on the right) using the four combinations which lead to a stereo channel. If this is not possible, all for possibilities to get an mono-channel are tried. Greetings, Rainer =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D // Rainer M=FCller A1200-030-50MHz 16MB/850MB // Pentium 166MHz 32MB/2.1GB // have a look at: Aminet:mus/edit/SampleE \\ // \X/ AMIGA for ever ! @endnode @node ID27_0 "socket.library (ID27_0)" From: dissident@mail.telepac.pt (Roberto) Date: Sun, 15 Nov 1998 18:08:28 +0000 Subject: socket.library I'm looking for examples on using socket.library (and TCP/IP in general) in AmigaE. Also, the modules for socket.library would be great! Anyone? - -- rOBERTo ->dissident@mail.telepac.pt<- ICQ:14501808 @endnode @node ID28_0 "ECLASS_ACTIVEWINDOW (ID28_0)" From: dave@shaye.demon.co.uk ("Dave Denton") Date: 15 Nov 98 22:47:12 +0000 Subject: Re:IECLASS_ACTIVEWINDOW Sorry if you have recieved this message twice, I sent it from the wrong account. :) I'm Sorry if your mail just took half a hour to down load, but I couldn't think of a better way to get my problem solved. I've tried all of the following: IECLASS_CLOSEWINDOW,IECLASS_SIZEWINDOW,IECLASS_REFRESHWINDOW, IECLASS_ACTIVEWINDOW,IECLASS_INACTIVEWINDOW,IECLASS_CHANGEWINDOW And just can't semmed to get a result from any of them on the line marked in the source. All I Really want is to know is when the active window has changed witout a slow loop constantly checking it with intuitionbase. PROC justdoit() DEF msg:PTR TO mn,ievent:PTR TO inputevent,sigrcvd,msgid,class,msgtype,num LOOP sigrcvd:=Wait(SIGBREAKF_CTRL_C OR cxsigbit) WHILE (msg:=GetMsg(messport)) ievent:=CxMsgData(msg) ; msgtype:=CxMsgType(msg) ; ReplyMsg(msg) SELECT msgtype CASE CXM_IEVENT class:=ievent.class SELECT class CASE IECLASS_RAWKEY buff:=New(100) num:=MapRawKey(ievent,buff,100,0) IF num=1 WriteF('\s\n',buff) ENDIF CASE IECLASS_ACTIVEWINDOW -> This here line is marked WriteF('IECLASS_ACTIVEWINDOW\n') ENDSELECT CASE CXM_COMMAND msgid:=CxMsgID(msg) SELECT msgid CASE CXCMD_DISABLE ActivateCxObj(brokerobj,0) CASE CXCMD_ENABLE ActivateCxObj(brokerobj,1) CASE CXCMD_KILL RETURN 0 CASE CXCMD_UNIQUE RETURN 0 CASE CXCMD_APPEAR WriteF('Appear\n') CASE CXCMD_DISAPPEAR WriteF('DisAppear\n') ENDSELECT ENDSELECT ENDWHILE IF (sigrcvd AND SIGBREAKF_CTRL_C) RETURN 0 ENDIF ENDLOOP ENDPROC Kind Regards D.A.Denton dave@shaye.demon.co.uk - -- @endnode @node ID28_1 "ECLASS_ACTIVEWINDOW (ID28_1)" Date: Mon, 16 Nov 1998 08:29:18 +0100 (MET) From: subvcbhd@calvados.zrz.TU-Berlin.DE (Henk Jonas) Subject: Re:IECLASS_ACTIVEWINDOW On 15 Nov 1998, Dave Denton wrote: > Sorry if you have recieved this message twice, I sent it from the wrong > account. :) >=20 > I'm Sorry if your mail just took half a hour to down load, but I couldn't > think of a better way to get my problem solved.=20 > =20 > I've tried all of the following:=20 >=20 > IECLASS_CLOSEWINDOW,IECLASS_SIZEWINDOW,IECLASS_REFRESHWINDOW, > IECLASS_ACTIVEWINDOW,IECLASS_INACTIVEWINDOW,IECLASS_CHANGEWINDOW Why you dont try to watch the window.userport for IDCMP_Meassages? If you watch for CLOSEWINDOW etc. you have a window open i think. Henk - ---------------------------------------------------------------- Henk Jonas | subvcbhd@linux.zrz.tu-berlin.de Student der | Energietechnik | http://www.cs.tu-berlin.de/~jonash > Ich lehne Atomenergie als Energiealternative ab! niX=B3 Castor < - ---------------------------------------------------------------- * AmigaMetaFileFormat * MetaView * Messlabor * Voxelflight * - ---------------------------------------------------------------- Fuer die 'Mitleser': ANARCHIEBNDAKWPKKRAFRADIKALTNTKPDPDSREVOLUT @endnode @node ID28_2 "ECLASS_ACTIVEWINDOW (ID28_2)" Date: Mon, 16 Nov 1998 15:58:55 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re:IECLASS_ACTIVEWINDOW [...] > > I've tried all of the following: > > > > IECLASS_CLOSEWINDOW,IECLASS_SIZEWINDOW,IECLASS_REFRESHWINDOW, > > IECLASS_ACTIVEWINDOW,IECLASS_INACTIVEWINDOW,IECLASS_CHANGEWINDOW > Why you dont try to watch the window.userport for IDCMP_Meassages? > If you watch for CLOSEWINDOW etc. you have a window open i think. Mumble mumble... I think this is not possible (in a legal way, however) as IDCMP_Messages are sent only to those window ports that require them and to which that message is relevant. If I press a closegadget on a window only the winport of that window will receive the IDCMP_CLOSEWINDOW signal. For another window to know that, it should get a copy of the windowport pointer stored in the window structure and then pay attention that that pointer remains valid. Moreover the 'visitor' would only know the same messages that the original window has asked for and would not be allowed to retrieve the msg from the port (otherwise it would conflict with the original window). Getting a message from a window means clearing the signal that signal the arrival of a message. So in practice only either the original window or the 'visitor' are allowed to access the message port. So that would be very complex (and with uncertain results). M&F @endnode @node ID28_3 "ECLASS_ACTIVEWINDOW (ID28_3)" Date: Mon, 16 Nov 1998 17:30:27 +0100 (MET) From: subvcbhd@calvados.zrz.TU-Berlin.DE (Henk Jonas) Subject: Re:IECLASS_ACTIVEWINDOW On Mon, 16 Nov 1998, mauro fontana wrote: > > Why you dont try to watch the window.userport for IDCMP_Meassages? > > If you watch for CLOSEWINDOW etc. you have a window open i think. >=20 > Mumble mumble... I think this is not possible (in a legal way, however) a= s > IDCMP_Messages are sent only to those window ports that require them and > [...] > the original window or the 'visitor' are allowed to access the message > port. So that would be very complex (and with uncertain results). Ah, sorry, now I understand what you want. You want to now if any window get some messages like CloseWindow etc. But i am not sure, but maybe the inputevents will be deleted from Intuition if they belong to Intuition. Are you sure that your inputhandler will be called BEFOR Intuition? Henk - ---------------------------------------------------------------- Henk Jonas | subvcbhd@linux.zrz.tu-berlin.de Student der | Energietechnik | http://www.cs.tu-berlin.de/~jonash > Ich lehne Atomenergie als Energiealternative ab! niX=B3 Castor < - ---------------------------------------------------------------- * AmigaMetaFileFormat * MetaView * Messlabor * Voxelflight * - ---------------------------------------------------------------- Fuer die 'Mitleser': ANARCHIEBNDAKWPKKRAFRADIKALTNTKPDPDSREVOLUT @endnode @node ID28_4 "ECLASS_ACTIVEWINDOW (ID28_4)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Mon, 16 Nov 1998 19:27:10 +0100 Subject: Re:IECLASS_ACTIVEWINDOW Warning: This is a message in MIME format. Your mail reader does not support MIME. Some parts of this message will be readable as plain text. To see the rest, you will need to upgrade your mail reader. This message was composed on an Amiga using the YAM mailer. YAM is available at http://bitcom.ch/~mbeck/ - --BOUNDARY.7624.524.119930688.1 Content-Type: text/plain Den 15-Nov-98, skrev Dave Denton: >I've tried all of the following: >IECLASS_CLOSEWINDOW,IECLASS_SIZEWINDOW,IECLASS_REFRESHWINDOW, >IECLASS_ACTIVEWINDOW,IECLASS_INACTIVEWINDOW,IECLASS_CHANGEWINDOW >And just can't semmed to get a result from any of them on the line marked >in the source. All I Really want is to know is when the active window has >changed witout a slow loop constantly checking it with intuitionbase. [...] Oh well, CX* just struck me: You're using commodities.library.. I have no experience of what that does or not. =) Here's a working example of doing it with input.device, attached. - --BOUNDARY.7624.524.119930688.1 Content-Type: text/plain; charset=iso-8859-1; name="activewin.e" Content-Transfer-Encoding: quoted-printable MODULE 'exec/ports' , 'exec/io' , 'exec/nodes' , 'exec/interrupts' , 'devices/input' , 'devices/inputevent' , 'dos/dos' RAISE "PORT" IF CreateMsgPort() =3D NIL RAISE "IORQ" IF CreateIORequest() =3D NIL RAISE "DEV" IF OpenDevice() <> FALSE OBJECT intdata a4 maintask ENDOBJECT PROC main() HANDLE DEF ioport =3D NIL : PTR TO mp , ioreq =3D NIL : PTR TO iostd , interrupt : is , inputopen =3D FALSE , active =3D FALSE , intdata : intdata , a4 ioport :=3D CreateMsgPort() ioreq :=3D CreateIORequest( ioport , SIZEOF iostd ) OpenDevice( 'input.device' , 0 , ioreq , 0 ) inputopen :=3D TRUE interrupt.ln.type :=3D NT_INTERRUPT interrupt.ln.pri :=3D 1 interrupt.ln.name :=3D 'ACTIVE_WINDOW-thingy' MOVE.L A4,a4 intdata.a4 :=3D a4 intdata.maintask :=3D FindTask( NIL ) interrupt.data :=3D intdata interrupt.code :=3D {int_code} ioreq.command :=3D IND_ADDHANDLER ioreq.data :=3D interrupt IF DoIO( ioreq ) THEN Raise( "INT" ) active :=3D TRUE LOOP IF ( Wait( SIGBREAKF_CTRL_C OR SIGBREAKF_CTRL_F ) AND SIGBREAKF_CTRL_= C ) THEN Raise( "^C" ) - -> Use a signal you allocate yourself WriteF( 'Window deactivated.\n' ) ENDLOOP EXCEPT IF ( active ) ioreq.command :=3D IND_REMHANDLER ioreq.data :=3D interrupt DoIO( ioreq ) ENDIF IF ( inputopen ) THEN CloseDevice ( ioreq ) IF ( ioreq ) THEN DeleteIORequest( ioreq ) IF ( ioport ) THEN DeleteMsgPort ( ioport ) ENDPROC - -> The whole interrupt should really be in asm, to minimize system slowdo= wn. This gets called A LOT! int_code: MOVEM.L A4/A5,-(A7) MOVE.L (A1),A4 MOVE.L A0,-(A7) MOVE.L 4(A1),-(A7) JSR __int_code(PC) LEA.L 8(A7),A7 MOVEM.L (A7)+,A4/A5 RTS PROC __int_code( inputevent : PTR TO inputevent , maintask ) IF ( inputevent.class =3D IECLASS_INACTIVEWINDOW ) THEN Signal( maintas= k , SIGBREAKF_CTRL_F ) ENDPROC inputevent - --BOUNDARY.7624.524.119930688.1-- @endnode @node ID29_0 "MUI Listtree programming ?? (ID29_0)" From: r.zimmerling@link-dd.cl.sub.de (Rene Zimmerling) Subject: MUI Listtree programming ?? Date: 12 Oct 1998 18:42:29 +0100 Hi ! I search examples of MUI Listtree Object Programming in E. (Listtree.mcc ist a MUI Customclass by Klaus Melchior) - -- ____________ __ / / Good Byte sagt Ren=E9 Zimmerling und MicroDot \ \/ / Amiga Member of Deutsche Amiga Software Schmiede \_\/ Rulez =20 DASS im WWW =3D http://programmierer.freepage.de/dassclub @endnode @node ID30_0 "E libraries and arexx (ID30_0)" Date: Tue, 17 Nov 1998 07:19:46 +0100 From: narg@polbox.com (Piotr Gapinski) Subject: E libraries and arexx Hello Can I create rexx libraries using emigaE? - -- Piotr @endnode @node ID30_1 "E libraries and arexx (ID30_1)" From: jason@fsel.com ("Jason Hulance") Subject: RE: E libraries and arexx Date: Tue, 17 Nov 1998 09:04:21 -0000 Piotr Gapinski wrote: > Can I create rexx libraries using emigaE? Yes, I would have thought so. You'd need to find some documentation on making ARexx libraries, of course. If you manage to find some then I for one would be very interested to see it... Cheers! - -- Your numbers are 7, 8, 7, 2, 9 and 10. The target is 545. The conundrum for today is "norlcheci" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID30_2 "E libraries and arexx (ID30_2)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Tue, 17 Nov 1998 08:11:10 +0100 Subject: Re: E libraries and arexx Den 17-Nov-98, skrev Piotr Gapinski: >Hello >Can I create rexx libraries using emigaE? I have no idea how arexx-libraries work, but since AddLib() takes an entrypoint, wich is normally -30 (the first function in a normal library, and E libraries too) it should be so simple as putting the arexxcode in the first function. I don't know what it should look like, but I have written a "normal" arexx interface, so I might be able to answer more general questions. @endnode @node ID30_3 "E libraries and arexx (ID30_3)" Date: Wed, 18 Nov 1998 07:50:19 +0100 From: narg@polbox.com (Piotr Gapinski) Subject: Re: E libraries and arexx Hello Carl Drougge wrote: > >Can I create rexx libraries using emigaE? > I have no idea how arexx-libraries work, but since AddLib() takes an > entrypoint, wich is normally -30 (the first function in a normal library, and > E libraries too) it should be so simple as putting the arexxcode in the first > function. BUT in docs Wouter wrote that e-library should be opened and closed only once. In arexx there is addlib and then? Libraries are opened on arexx process? - -- Piotr @endnode @node ID30_4 "E libraries and arexx (ID30_4)" From: jtierney@cyberlink-inc.com (Jody Tierney) Date: Wed, 18 Nov 1998 17:18:49 -0500 Subject: Re: E libraries and arexx Warning: This is a message in MIME format. Your mail reader does not support MIME. Some parts of this message will be readable as plain text. To see the rest, you will need to upgrade your mail reader. - --BOUNDARY.1746629912.1 Content-Type: text/plain Hi, On 17-Nov-98, Jason Hulance wrote: JH>> Can I create rexx libraries using emigaE? JH> JH> Yes, I would have thought so. You'd need to find some documentation on JH> making ARexx libraries, of course. If you manage to find some then I for JH> one would be very interested to see it... The attached file contains the highlights of the "Function Libraries" chapter of Commodore's "Amiga Programmer's Guide to ARexx" (reprinted without permission - shhh, don't tell anyone. :-) ). The parts I didn't include are: - The summary on what a libray is, & how to open & close one. - The "Creating Function Libraries with SAS/C" section. - The "Creating Function Libraries with Aztec C" section. - The Aztec & SAS C example source (Sorry, ran out of time. If necessary, I can type these in (why weren't they included on the disk?!) and mail them later). - -- - J. -*- Team AMIGA -*- jtierney@cyberlink-inc.com http://www.cyberlink-inc.com/jtierney - --BOUNDARY.1746629912.1 Content-Type: application/x-lha; name="RexxLibs.lha" Content-Disposition: attachment; filename="RexxLibs.lha" Content-Transfer-Encoding: base64 J4gtbGg1LToGAACVDwAAoIhyJQAAEUFSZXh4RnVuY0xpYnMudHh09PEE+2qa1cjbj2OvgD6z BrYc2N0LcC4fEcsGEkcHHS4kFu77e5D3UuiS18+vxx/8kt3e5txwkIWBaXfAe7VtJwi9XfWb 9kYFFfabSte68vS6+91jnn+cC9Gm9mpZe97tT133m8fH68GWGUXFp6z7+/0cqlenWvZE3lz/ p+5F/GDa4sc0vYyp63sOA8FXl8u4um/Zcd5titPmVyf9/KItLZzArqQFkCWUIrbYt9hTqiGt bzsy8KOtcStddc7aLi1mqtze4TMTGBWHCt7Kh5zGj7BDq52OlX9ZjxnrbXuV40L85FrXAmAQ HbWlYuK4bF1noKrCJVraVRj/rrh6AolbRSTLzKrcn5qbhfUA2daWyYwQ5SLpH6uhBlVwg252 AmDsLrCvBQp+7ytxEulBqfSrI6C2sjrIF8y1i7jlSJCfurXEUHZuau9iUhuJyTi1AVQRK+2c 6EgU0x5QN8Ac3UZarnVLulCvCkDbDB5zGP7UvIG1qE87XADrzSIMhekbSk9pOalENPG/5fTX WcJFblB0DqQcaFOHzv2shQCkpQKSY2J6nsjuAS7pDm68RK8ePYLX7BCz71onHNHrVcDzRJuQ jBAHIWmVDsbqLqSZ5rOJEDzCoDdDXvrRrm8nq7zryAqBcXS2ODJAsFUzVN0dXwz8HQq0EVSn uObgkMUKUlcVKwmPV+EAtBjx/rthtkEq9gurY9gOFXipyl9eZLw7TuOKUjGUBMUw63wYGISj M0maE/tArC5rHS8QLeOteAIRkZ0lvLSbpIboRO/JUOV28qPIkYnlEy2ySpVLCzJYG7wQGFRv jhsBs2GoeFlfzz+WDM70QoNuun1+d8iT5h6jlG2JDIRdJZOcuqWLd2ORLD4TwQfSHBPPDx1Q i/CuIYpQeLlxRLV5x1usxqiAOuIZ2zuOjqK5ZApEDlQCuF3yRyxEvRDKTgFTCuwIZhVPT7ff 1dfZp93YMvftTDC6b1PTvUJiktGLMulnFyycZNkeakkGTBfyGQZLF6GDGnGvXlnZV/maIC6t 5B+s0CIk5zRphA1aA8L7YIMsAaTbdMSw2JLCsxnOXscUHATRgJhjlWTx/lgY9nHxOOg+jG7A wdNv3hbPwiPYuEJ5A52RilBXmkdjQJEqIpDsdb/sZCNKI+k62suuC6lUsMaDvGT4o5Emga31 60xDJgmzEPyjavGNxSEIdq6LXloInJJW4mrQl6lpX4itzEYnbmjJQ+6GGzY58aalLXYNBix/ FoTmi5/jl9arAvSuNyYjerLN6NjRve581v5jlUNRJQdPSrOr02jBI0WNwGODIDvMbFKoCSXV mYP3PxOB5R28s4BJK/bDUWTxFT4HGMrgu9NK+fA/XPHeFFwXqPgjRClnJtbsUCgBrbQ7EMOz 4N6YPGQndm+F+KgvqqTIVJKANcs39RpVaYHZ0JjDUMTlk52XAdyhaU5CRoqaluUwccAjkeiV fp6/XzSxDJhhW/VgnG6hT6eebKfXz/ryq4uscdWXDWHx7ZDom/xFeNwCGscqY4VWtg+xjbEy ASQiN2EUxs4x8YBk0yLGJNcHNXUnDRO1eF0S7l3YHKLCs4Jlx03DSimsAwkKWxidjWsMaWB5 KqfJgOGbnxesrM5eMi/ltzO0/MIhsLPuN+imnAIdarLMwMyCUgEboPyNw4LLywh1bpaZqJOv QOk8a+q7cq4cWjBCqeeoLKAPT5Qc/0HORyTqr75euQv6xwd/Zdk8NOjKQFp5hat1k1h0X2IO WJQaKW3j537b/O+uySTfv9oWYbw30H0c0+B6kZl6kuOONpCUPPzpYH54gB5osj+ze7xsbOBL 8SLlSXXw+GGPK7XNFacikJbROcmNS2by+DS/V8JelxceVg6Fa5O+Xj0ifPR1PiF3Qd//EQQ3 vgcYog2dQ+Zsz5Mn4ldjjnwEaZpt+hvQXgQWehul+psW4EIFR89DukOYxsjhVV9owvD8seka PGVPnbeGCWeZGXQvpmkBXe53kxak5A4JPKZAFJkAkUs7pnoRdXXg9OOIOFSOJWdeEgm4W9jU /hpE4tUi5R8w+jn40kvRzcNOujEKwd+fEc3gpMC0TFLkM/GaJvjlL/K1GN4KITEFPeKmwynp TwYJ6iscEEN/yfPLmAMAAA== - --BOUNDARY.1746629912.1-- @endnode @node ID30_5 "E libraries and arexx (ID30_5)" From: jason@fsel.com ("Jason Hulance") Subject: RE: E libraries and arexx Date: Thu, 19 Nov 1998 10:17:08 -0000 Jody Tierney wrote: > The attached file contains the highlights of the "Function Libraries" > chapter of Commodore's "Amiga Programmer's Guide to ARexx" Wow! Is that all the official documentation there is? I thought it was thin on the ground, but that's ridiculous. An example or three would be nice... Is there anything on the Amiga Developer's CD? I suppose that explains why there are so few ARexx libraries and why the language didn't really take off as well as CBM might have hoped. Cheers! - -- Your numbers are 50, 8, 3, 4, 3 and 2. The target is 245. The conundrum for today is "endivcoba" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID30_6 "E libraries and arexx (ID30_6)" Date: Thu, 19 Nov 1998 11:44:30 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: RE: E libraries and arexx > I suppose that explains why there are so few ARexx libraries and why the > language didn't really take off as well as CBM might have hoped. I don't now what's an Arexx Library, in the sense what are its differences with a normal library. However I just want to point out that, AFAIK, Arexx was added as a intercommunicating language between programs, which is exactly what it has become and highly supported. The fact that it can also be used for simple scripting does not mean it is a good tool to develop entire application. It is an interpreted language, so very very slow. For this point of view, I think we are lucky it has never taken off (otherwise we now would have tons of applications absurdly written in Arexx). However it is well established, supported and relatively powerful as a communication language between programs, that was its main aim, I suppose. M&F @endnode @node ID30_7 "E libraries and arexx (ID30_7)" From: jason@fsel.com ("Jason Hulance") Subject: RE: E libraries and arexx Date: Thu, 19 Nov 1998 13:55:07 -0000 mauro fontana wrote: > However I just want to point out that, AFAIK, Arexx > was added as a intercommunicating language between programs, which is > exactly what it has become and highly supported. Yes, it does do interprocess commication, and in this way, yes, it is well supported. > The fact that it can also be used for simple scripting does not mean it > is a good tool to develop entire application. It is an interpreted > language, so very very slow. For this point of view, I think we are lucky > it has never taken off (otherwise we now would have tons of applications > absurdly written in Arexx). Err... just like BASIC. I think CBM saw ARexx as a way to bundle the machine with a programming language, much like they did originally with Microsoft BASIC. And there's absolutely nothing wrong with that idea. (Even BASIC has its legitimate uses [mainly for prototyping].) People have done libraries that allow ARexx to use Intuition functions (for example), but it seems to have been a case of too little, too late. It's a real shame. ARexx is not just a scripting language. It has quite a few nice features, and CBM never seemed to promote well enough. Cheers! - -- Your numbers are 25, 5, 1, 2, 7 and 7. The target is 677. The conundrum for today is "lgthsiied" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID30_8 "E libraries and arexx (ID30_8)" Date: Thu, 19 Nov 1998 12:13:22 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: E libraries and arexx Jason Hulance wrote: People have done libraries that allow > ARexx to use Intuition functions (for example), but it seems to have been > a case of too little, too late. It's a real shame. ARexx is not just > a scripting language. It has quite a few nice features, and CBM never > seemed to promote well enough. Well... did you ever see Comodore actually 'promote' something... I'd rather say they put arexx as a 'surprise'... I remember my A1200 did not even have documentation of any kind on AREXX... its not even mentioned!!! If I look at AREXX globally, I think its missive was never well defined by Comodore and When I look back I see that programmers defined it themselves... just look at the slew of applications now supporting AREXX as an automation tool and macro builder! I mean even the little puny utilities now aim and strive to put AREXX support in them. Just remember that its still not possible to do all of that on anything else... yes there are similar systems on other OSes (REXX is actually on OS/2) but HOW MANY ACTUALLY suport a full - -fledged IPC system and then how many support the same API ;) I am trying to get a several hundred dollar POP Mailer to be automated on a Windows NT system and its not even able to properly recognize automated keystrokes sent by another application... :( major pain for me... I could not even think of achieving (on WinTel) what had been done with AdPro when several AREXX built GUIs were popping up to control it in dedicated ways... safely and without any glitches. - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID30_9 "E libraries and arexx (ID30_9)" Date: Thu, 19 Nov 1998 12:03:58 +0000 From: oeolsson@tmisnet.com (Ola Olsson) Subject: Re: E libraries and arexx Maxim Olivier-Adlhoch wrote: > I could not even think of achieving (on WinTel) what had been done with AdPro > when several AREXX built GUIs were popping up to control it in dedicated > ways... safely and without any glitches. Here, here! I spent more than 6 months writing a data entry interface for Win95 that had to interactively control MS Word, MS Access, and MS Excel. Geez! What a mess. ARexx is an elegant jewell compared to what MS passes off as IPC. The command structure for these programs is different when running them internally than when running externally. MS keeps changing the Object structure between versions without any concern, it seems, that it corresponds to what was used before. I hope ARexx never goes away on the Amiga. Best Regards, Ola Olsson @endnode @node ID30_10 "E libraries and arexx (ID30_10)" From: jtierney@cyberlink-inc.com (Jody Tierney) Date: Mon, 23 Nov 1998 19:12:46 -0500 Subject: Re: E libraries and arexx Warning: This is a message in MIME format. Your mail reader does not support MIME. Some parts of this message will be readable as plain text. To see the rest, you will need to upgrade your mail reader. - --BOUNDARY.1747157976.1 Content-Type: text/plain On 19-Nov-98, Jason Hulance wrote: JH>> The attached file contains the highlights of the "Function Libraries" JH>> chapter of Commodore's "Amiga Programmer's Guide to ARexx" JH> JH> Wow! Is that all the official documentation there is? AFAIK (but how much is that? ;-) ). JH> An example or three would be nice... Three? Remember, this is a C= manual. :-) ...But I finally did get the example typed in (attached). JH> Is there anything on the Amiga Developer's CD? Not that I recall... - -- - J. -*- Team AMIGA -*- jtierney@cyberlink-inc.com http://www.cyberlink-inc.com/jtierney - --BOUNDARY.1747157976.1 Content-Type: application/x-lha; name="SmplRxLib.lha" Content-Disposition: attachment; filename="SmplRxLib.lha" Content-Transfer-Encoding: base64 IGEtbGg1LdMDAAALCgAA4ph3JQAACmFyZXh4bGliLmOhYgMma7vRpt0Pzv4A/0qUrZQI5Est 4JZEnAJKKkCpgJTKaJrhnMOUYyV9wWClnxu//fc2whrJtKslktvBllt498AbmG2cbae/VaCq BpT93dGjHYhCvXDB2HjOrRIEOjIcItEoQynMpEmUDSA8+PLCLTJCpA8MerKaXXYFjb7TXrRJ DHpHq+5KpR6FjNybEcKtfackVKOpM+rGap9USdaShDzUMStevIeJEhxg+309Nq5g+L2Gz7wu 373OEECTaj5El+FZDS5U0869iu3bPvefD2fm77KU3xfv88F6/hg5r+K9aC2+/wOwOu8FHA5X rUF7F0QPP8+AAn4HB+NHA5sV6zAKYF+T8DhaaSoaeQhy3790MCpbfybhzGlCqasC/xjc4vrx Ln24tDMmmfCdKuYbENjWzTCoLq7FhVK0WDWnlMk9YGLCR9CcoVc6ctZoP28W56sp06Y1QLuC 4PK75uduThxgyIHAskB47w1nmVN1McZpVVKwfgMZF2pTq0yyNv2YL/wmReHnJHD95F/mQlrR Szf0fvbIotGvyS54CBf1cHX/85j9Vh9xnkL9OfxPEUcB5FDMHMwod1CVdXWHHRE3fUUNEIhq A7N6nvP4Vti7L4ruGdWQ3/AnQILFncefGqNpCe0yocxHfw5kJAfSswlT+Wk8uupSc8j3EoYd ehQR4POt1xQzFCg+o6QNSxJTi1kqBEkzLFp5w0RDg99GI/0kTsM50pNlPYY1SpwuI1/teI0W jad9GKaTIWJ409kawIJ466xdN51mKDdgt8aNTh/fpDB/QTqLkr8qxRrvrMNOnwY/1GYqRIrb GkhRdxTiN/cfo3K9BGFetitETfqGMQ+n0BucZDy7Gbw1gs37VvoewfBwPVxsre41RDpCi3ZA HGNbZAhD81aEZCH5f7TyMihtvFy/lhtklqbM27AfEKO65siPY0P8gAQdNxRi+9pLOIa81+SQ 2c5SdNQUPb7Yo52iLoZlC8juEbDqd661DBccowi4xOl2UxWLP72tlpioB+tWh0ITVZZ2Ju0v n+6ZyZ0STYUis0tPyLTm7pk9L/WCcXNt018TFx40n8+STIi7W/HJTMLjcLFbE8JmIHe1+jE3 V5Zy1ybvjg+pOsnNo0xiWWP5m1pnMttLmRckUm8dmLkyic7uEP5ZDQ3t7yGgu5dIF/+03EGW ev9mPQk84m9obfHMguDJ8yK8k825osj77I+wv4rZSir56AW6khnLBSzCX/e9ejBUx7ixoc/a 2PBxuFN7vlAVxcB3Udh1tQeVpUEIyFXRIk8iUKRqP9oCuf7AaFwJugMgZC1saDUt8gAAAKMB AABhlHclAAAKYXJleHhsaWIuaBfEAOpal621E+f/gD814boJr0ZEFbhcFchsIZ4oTW/tsC2F J+ZLRHxukmKigrwMgQRNKZACgVNLHG5fLVa/7MASLrZUVY9u/Zx40be5Pinbu76PSfZOEjyF sL/LfsMpu51EPWWJUzPUmqasj1W9n4q8PXh+rGe3ojDjyOMR0BITKl1gDssChvm5vOlw13JJ jm5AI+7+iNNqmihiry1x/rY4RvWxKm2H9hKx+gqPPd4DKivDTLms0Rm2Qo6swd74h5HZAHoy oHTDe+IoWcJ1gBYuJrOiolJq9iqOHh1UHF96etzrPBTqbZf5dvOz5YOVymueyAAdlS1saDUt 1gEAAMMDAACRk3clAAAHbG1rZmlsZRLYAa1jl62m43zvwB+qCQCWk1OSiV4CgRIyojINkrwC QmOOWvVxuptwpL44//IMJdxbJbi10ARtJ28a8G3Lt+uYF0+tClpChrgQ5J4KZ5gdgZdieXIK KmIgprAWrg47qwQda0zje4DuGgGNLzlYDXjG++zRNp8u8N/jp8A/3rwezk0K5WGUReJQ82nO VJ3h2U1jMDHL2hh1HrDux4tztzOy0CGlfBwqs03Ov6I+if+GQ0pOYwpfaVaNRkWgl3/VBalV JeEGj0Z6h7qh6fQFUDhqs2XYTeuMosX9gjD0pBtEXEYcaZZ5wbw/SUQsRtg9D0U8aN8JZZTa /D7RTyWQlaDzv811JlJDcFMUUPobNETEVzFrZIhCYlZBQ6Nv4bFTiyBfwkM4jAHCxnDFt1UM m3hiKGOVb+HTns5zFzmHnuNFp/jWERIJtmvVEWKuHmWWyIkN9q+tQKSfk5qip8G0q+E9WEgs BHHC1banXfAor3q5sgXWAkC0BJSsJOIST7/zt0a/HPo8tGbf80po457RvY8zjeHfSElV0K1N EsxyC9PPTNDm02ZSwPFMoTgCdTh1w0dzKZarh/QQ4tXVSklf01AJhHn/1b1pDR3fbdFyuVUi lMQuqdPzNMAfNi1saDUtaQEAAJsCAAAKknclAAAJc2FzZ2x1ZS5h2S8BaGOTjbiiOPNAPJGC CLZavKgEVGB5fwfSuAL0ZPSPrYz3W4d3P6GnLm7JfqRgBV2EabW0EFOMJlaNm2nwB+MHoDfl wIBvWYwBz0xFb8AOU1fEmlioc3wgFxBeMIE62hvxUMZpgSAJ8Z8iiqBKNaUijf5gMXU6xqUa XMw3UMdbDwnG9XyjoYhI3x41OGSTgoPiHfrtAN74+dCq0yrnzXAIPua2WjnYA3BfJxBwkdez TzE/42SWACFWxBUFY0D9mXAKe7/Le+7wywuyzf4/bPp9GDcpehcrYNlvdqd8NTtmnZ8tQ92k fjo0+1MfdSlJO79UBezZoTEM/bQ3GQqycFyxlTCQ9BN43QLKr0Jpj0o+ZP7spTb0sziGMnxU j7DR1/8bmuzB/yh/7U2D+GsPqBGbIzXf2pLndMz+f9zPyKjB5N1leRYRS6+/QOv1D1yJFo19 nZKOgjqlrsktYCapVeHdF47LRSMUXWWAAA== - --BOUNDARY.1747157976.1-- @endnode @node ID31_0 "UU Encoding (ID31_0)" Date: Tue, 17 Nov 1998 12:11:53 +0100 From: raptor@cs.tu-berlin.de (Gul Dukat) Subject: UU Encoding This is a multi-part message in MIME format. - --------------402ABD87835 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Hello guys ! A module for doing UU (en/de)coding was requested, so here it is. I wanted to upload it yesterday but I've simply forgotten the disc at home (Sorry !). Read the documentation !!! - --------------402ABD87835 Content-Type: application/x-lha; name="UUCode.lha" Content-Transfer-Encoding: base64 Content-Disposition: inline; filename="UUCode.lha" H4MtbGg1LYILAAAQFQAADglxJQAACUthc2lDb2RlcuBjCW9z4e6xNOUfd3d3d545p1u6WdK2 W/3p154L3d4tiudU2eAAeo18XHWls2rni0DyFAPbg66ubGeFArCMmuyxljGOYxldJq3XOzZt JYwLrLFJYzsxjLtCKtxmmuuyS4XEJ1P/33/3uO4AurI7fu3d1tcbbcwA2/0DH5oGh+cdwIf+ xd4nDBvTyIwGqQDZvoFSWFggpyj7awXt26z5SZECb5Q+/ExvyJh8c4s6pus8sDwqavPi+d7q nKz/5wo9h+kOTb7Cq/uG+H3XZ7+bTRz5FVnB+emkH+SVqjeGZ0Xip+Ev9MofpCLxBA5VZnBv Vu5U5XY6Q5GaqATdID0RA8wQMPQA/AIH0okcUF54+uaPfHHv61NYnnSqi1vb6NdXG/l2kvxw uLy/mXF/cXt5oAVZdot41xwKGCBT94BqrAur30I10edYck+Yq/iXR/ggRD5kNpfhwiW/4YDc euQTMYN0frGdqvYFganH1shDxjO7fLgDkxXffj36LPeaXeFEPkKuyaLArB98ODEPkqb5hprL efF/hY+dioI7VSYpuz5MjqbELH5z9HZ2J8yr3idSG1AKv1xA/uEDOQBryAmigkLqwDWQIoPY iEBnejs44JLBs458oR7x4uANcEcG8I2tcGUAJI8eaOHeJxQfEvv2OnY/ODccnkiSX0ER7b/D BPP0xC5Zop8tUGtSRnQN/zRG5ojc0RqWzuz5J+tI6j0k9zCCpxwCqzqT+Jkh8W5IemBJqmIU HZkhQ14DWfE33Pig3HkBxaRF/cfGGqFmfpj3SolXLIqj3zCKa0XTxp/hLGjGq6uwDqmdCvLm NFF2Y88biilvWhjmYUU85YIgJurQHMEl7NWPV7Ly1gpxzMlfl4XBAIhnKYJt02w4Pfjg0oAG 2M3AiAZvZrwwM23q8ILPClAf3tJtOuM5aj5h4CYWgOOhRLrueZS79pk7vkT2TnnUWQpMTf/+ YyWBWz2H3n6xIKAbzFkLyMUm1nytECSg4uBYLqhn8v6j+/0D/k//P8Ac+zAbkIQvsEhYhcvt BSQ9Effmjmc1TxER35TMd/HjUqI27VmO3jw9P36OhH6zIf2JwgcogJQhVfrrBCAYoXmnF+Lr 3KoNOqT203KbpEd/mk894ucf1nPZW2+tlLT1RgDdSOGc5ZnV7kcy8ZIvjIe24F+eSm6qs5L3 00pHDBwjDwyw5Z8OeZ1vl0wESijfq/iI9z5VWINaLr2APNoIKuhBQ8lY9OGhPjETFpInHxE0 hYzOM3cknbuMuJlboMuIJlei3mCziahnEiQezhRdXlf8nVKBfMKT1bsQgEj8clhdfMhYW2os OtEg5lF9qw8+MLNSjHFURkFlliyoV7OqYmLHK1dGIHMZnTnMw/5upOrNKGnl+wVGcURnIRFy scu+fEgOaJ7Ql5mxQytodCGUAKGUqd48vRREqeKUQgJVBUk3Izy+2wko1IUNnE1/thRUer5E DcW7KMmKRlIGMJ7i0Bpk6ND+GCwDR9cDRD4o0Q6kzdMjG/KiK119CiLDJ5b+zXE2v2KJJFHe F7vrPijRT9sfd7Ropt6FFNpL7VFMs7YL3gH3TFV8zkjPRllnai/3PaX9x2l/5WkgrxZsLw5y Jz2peJMdIprVM32CpZlAu+3rBZp2hnN6AN7LCKrSZwPnKYYSwgLb8BG2GEZoitLr56bpgseC EDYm2ImeOUYJMpRG+gysMxR7xRZq5m4MQJJVhfTokEGCDov/KtGhU9cR/JcxQPIJKxMevHnW 0A7fcMh26wUc+khwZ6DIRVPW6AfwEImZGVlaOVRB3KtyZqUW+sIG3Ri2MvoYu7FsIPXqKFbV DS0IOT8z+Sh+d2CT1fSw6Jx30csOgm1Cc8jwwaUcDuNDA0rFFVBVhzyrq44NNTLtdQs1NEst UYFzqFltQLOf71EstaGXoRi5/Jo4FtPVMu8sNYKBzcDQ82s3AoTi0tFk4kX0iIsbSXMQuGQW JpJeIVYgtPQCtkBfvEFhgVePRXMoSZ7UdNorCysuLYwdL2XFjnXE9mum82hnUNzYwrai0+fn 2Z8dLHk0lJlk6VFk6U9k4x45ejPj9Wo1uwekQbL2AQ0HsIX+ECbafXZ7U4MnCjI0mJU3SnL5 eGNNvas023paUXPtdSm293pUy3pnVmvGCywxmfx56oiPuzzoAuFM2Gtz0h17PGnyTooz05Fm ek5JHO5hJGRd5eAxcZhs2AS0w5MrIWjQs7nTr50oaRZSWbImfa06KfPZXGNPXHiogNpdEXDa Eio06cIjXjYwnksXrU3OnBvNwi1EM3DoOJJB3X/UHYrAiVcPRqexib26vSqKuuNh9mEHGnA2 KzGPeLN4omf5NOnGJf70nAsU7SaOR7ZbTUlr9xPb4gctoyF3RBSzpEmuUrQ2V8XFXXeDt1At ry1d31x+O2Nsrq1dkG39srcXheptlfOwFz7WvtBVMdsPk0Fv0NR++BuGp+iBPv91Wc0+VGp1 KtuWvP1NTHO6c/XnjpiWpq80MG6NaujXa2C43kYIkNdnRuoHsaN8bk5QaktfNQHYto7AfMYU 6BJ+gqrKVOUJ9lpi0d2LGbG095uhtPcFMGTe9JO2UvaltfyKfX2xaVcaNLgc3EFhOMhH80zi Muzoq+IS2ik42bWmqZ01b4cT5CNLCJDDNRKi6Z26/IZH7nQH9Ih6wT3/wbOustsbwrS+uKy9 tbaWbaRqg0Pad5FUveFF+131Mb75q20vLi2uiwV3bS71W6mG8QFL01pLVvjdy7CHXXidbbU3 AvbW4vFTX0zgcC2vr63mXRC93u66XLh0xvtofr35tve0fd2FfcXVsaBsr6Aa24dxfX/dXxrS 6l21pa+OWb26lft9xXJ1USx3e6Z8a2urLGtrk5MRSxrJFdWeFJ3fhpyQvzjB7MHfBlp5a+sF XTJjYh/EklXZwbUt77Cuj4sGkGK/6R3z+aarsH9uB535edCrISUny2WszTNoVIpM1uKpMFl9 PAS09W2MUuYXwHIyT+ks+KLM10fKUm1liptqhPabRPve7qE++qE7GZfrTL8dWYVgBzAvRQ29 B5ZLyV1Xn7Erd4Oi6A57fLWFNR0EszTw8GRLDawzzvZXuWpmkEFX8ld7/JVL7vuHzno0p7KP 58fvKs+eZ2pMnrKS4itNXqLTVsjxKYmMSnBD6yXAayMYieS8yOpsAg3oP6dMH3EB7rhajyXg 7cTg5knEeawItu3ssTiHHxgiJ9Ye+yGV/WVnVCkNYPdcOJ21y5HrUXPXk4kN3+vHVulg9r3b m38HOCBwh1+EHuG7YKiA26HOkVfO50iq+HAm+XbSPa9y36cqGz8TiNBktt22ygDunoNMP1Ap auOHH9Bdx9Hyh3/o44cf9QP7DCVbmrjYNhhqta1eA3GM3hk0uWDAmr4zAGyxDWEIbct+D1+K L+Dc1pI7wUkJTUSurJ8yGlzPMV6A87AbGphD1VzGGjxUPKsDKgflf1/R76+98qV8RmkrDQN5 krHHvacHnj1VufblcgvW5cjk/sysceu8lc/UOu0VzSOqvXZNoH3o9X7JvqFWrjGZNsey8qVk iaQPrxgNbwJD1+rrUG36R6+Rc5Yl82rjnPK+Y3bE63uCda+hu4yYP+IFTTnnZGIUWPCae10F dfAdQXdliF8G68HQZ8EzynB2MPeSsEnEgO3wwB/mwTVu0qj54st6SkyTiLCWZHUpAgJg9v89 mPvkxgVjwAh1Jz5841KkLp1Wu7wbH/cgINKI/0YiYcStR7jT1fDRjdmciUZqkyA6EfyFJlp9 Kx2AIxKpCXW/9PUoefTZ88D5xkJCRHkYsjGUmFXxbdYemvYr+tRgZb5w/JB92PI1PXG+HnhD zkDfSHflOfuDVmswDtvVHnHHkc27gjyOi/pH48jv/6QR9IsPPoDWcEH24lPt4Q87kefPHn2R VwW1NHLBzbdcIb4tbGg1LSsDAACpCwAABglxJQIAC0thc2lDb2Rlci5lf0ACvGq31ba1y486 AflEJbiS3bH6H7XajSyTamtkpLbkTWlPaT1thpZKe96P/+6EnoG3Rh96SSWuU2NheFniqPNQ eGhuK9BTnbRrK025q+0C64/PzxIJtKAkM9180ecxNNZPLAcRDwW43ymrFD681hgWpEaIzVpw xgkUBYUiekoksMgbxiakRm9Tx6yJF+UpoYIqz5bPaGMFO8aDUiCOIQzCU6NUzVhmjMCvMLVa YDVpJHhbBX3dzM/qGddRT9yC7ouuSwAP9pBd70OX8IOs8Ab4efYUWQMXPAdBTLxizOmA5Es+ p4QYvRvyQl/sGLzjGK6yCu1PTz4P3bGhBBIkH/j9st4rwWneDLcbauDARPFk0K6iI0BHmBGg oQRapEZoIU6IVQGGWrAN3Lo5KqkqglfcxYaADqX45EUgHzX2GbbjGw/fKmRfXASdfatXcDPv X23LfCzb4sAudLWq/HEqgJDlB7QV7mPJpP2L/hXMF4kEX31gu+dS9no6AvuuWw0iwKlOGpVU GCQ4spDZzhYC/hdDC4F1xvgo9Jn0+tYcJTGUGOtCaAWN8ORMzlpuksWJ+wZJkmZdSkulI/aH HUBWanCvaWno5HDNQHXwLa5mV8Cq1BZKQyzzubGUDesp86ktBQ+hoaZrpYs6NFShY5OmqHIF ULO+G3NR2HrNAgrQsglYDy4z+UC/+OohjIcCQmFsOcPJji1sN1BsoQyL3qKU6qhIf+JznB6P TqIaCLOBM4xqOieDBye0dOndX/wOXnQOHUU1CWcdXyYGuNfAynsiyJfGUGUooumkumMEkmVi WzlLm7qenxgLPfPk+jnTuh2kDMX4IFup19l3Wt2ww8LLYYsQ6zjO7Kxk+TcWlnFfIZHyORm/ S4jbFxpTpielxxJMWJl13K5xWvZS8lNBI+sxqlUdynG+HpC5HrzUUECCrU+jthlSG1GYq7Ba owzTQOeR54pz5pIZaVexqdmJoxSzWX6670qNJTSStxhL7aRScFHsm+mW/2z46dzBEE8dO6En Ll4ymOP4zLClvhtOgr5uNl3Z+xINytthU3POu3H7V/R/tUdMfr/XDkVW2xhsHj8tbGg1LUkH AABkDwAA7QNxJQAACHV1Y29kZS5t/W4FonKi3dG23KPyXcuXZVGa0GQhBhOzJGIbSXXMpjGG FbcildkkTg3G5djXRyxqPTZpvhtwKYxTntG34cYnkhiE8G8GmMaMfgxTbEKSBi+DFKLYxjGK FpRmrKPavwPwQomu++/93Jck3I6bb37cJo223LR6OLzEkIi66D6YkH0pX6sMT6WQ9s4nychM X5nvevsV7dw+o3gJfomH4AB/cANZQHmkC1PRnnO9hE4l3PSZOzXv60tet+e+wUZcS+wXtoD5 ct1Ej9sEctrAOnKRGVafECeW3PS5pfvC5+xi/Mi4M9kIm55IHrf6fR73xgLuNT3tzMSPgFTq G/7iG+UDfKBrN9Ue2XtvE+SYW93SFbwUTC+f0P5tMjSuWPbQtq2AqSmmQxstI8MBvq9VFxlA VslP9D4U+nS16/fH+zEldwpUf+6Um5P3y17+xLaCNSaiJ8rUkPyxQnvbYL9vuawa3bmg5vJ7 1ZxJyNyesjHJL9tcuY7jfkcS9Bzju7Gp+BEnNMNo2u2sCP2ARs3aNcirpzkaXyXZqNLes7eJ k6mUj3v2408dpiONaem2nWSR7sSdlQqU//DCeV+mGE71aKELKRoIO/8gySFyu/O97bLConU8 eI7ieMxre2rQEuD49PnO5iV9j6F/xrC/2f/r+7B/BQb8CmL3ixYC7nCFLH/DWCM/KDny0vXp doV37UFd/doXCq28uCu3uzd/f71iv2Cw/erADtECaQsPwOJeIKoZe/V+JXsZiRvlM222G5Kq 7/SMz5brw+yYYVrf9hTG/QKA5OJ7Lzyjm8BzLgQt+qbcgTz2W5OF87P9G2cT2UkKF8ok5P0/ i1J+462gEooS2V3Daq/RrFK98D4rLCuqYVPacevUsX4zmxEkLH122RBms0uwW7lUHQpV1KWg FLMEeeTAU+jAUhA+YlEq9rz3qmhfdNnrm9eIEP3S8Mn/KnhW4Hh4oQO7FO1wZ+8IamscOiLB dAlZ4K77CfuLBrhxVA7sF6daCn/y8F6tU007HhPDOGRrKZFhx4/9eddsRLtTXtLGmVabZplR DTKeO8ZmBkfjMhZxAnkFZbYF8vuPtKOSFUZwq/23k9W25VQ3PqGsmeVKQYpPkdZI2za4P5qO IOH2QOEPWHCHgNLtlR8Y8Ise6s8Is0zL42S6Fbxn+EkpHqHfc5OsOFP3BvmRcKa9nhTjaHDw pk95zucj3Tf5X2mCp4rZa3A//3+F/5HC/+vbYWW4sJh1lXnxzpMHSk3MCr4TxZqoX+2+mb2M 0xnjrqxtQ8tLUga8p+BL7ArfdKtmpQjK5pbqFt20ce5KXfIa5AU+CawTClVb6lK/DFW+eIas Ve3OTHPML34kCj6BtT/PNGp0+OV+XzDB/AWrCjuhni2Q6/QgDruJEfsqkG9ZhCHT4tgP6amT aUa5Vo1VR3ldgw1NW/EINdRW+b2CuoIwpMmK4K46ol88sOZ5ve0qedRGZjtsnfvH5xJ1I30W 4UPNSNEQ8+wQ3D/CqpKzYUr9TBSNwG8fgTOBEmY6iFjgTK1lM1/fiTMeyb2axa/7IiFaF0z/ 6CcQMHV07GuPV07N4txFCcIXvFC0Lb5gLqkLOtteArhC3tkKsoKar15qHnjtPmaSYYo78RX3 lgkW+R3HmkWD2RDDXfmbZPVRzfJVoonwn8F+NsvMSWYITsxQnZhhOK8dy1fj9Hka1EmFA43h RUQd5T/3iNrWOdnz3g4+pQV4mJ43TeXsao427+DjbmHxRa+Xwcbcz1jxlzGpOS7QTG1Rc//K F0QPqPVrsSFaWHNz/elr73chsnVwz3pTMLTlo63tloyndjTf7GZsHQCfGHMKyLV4LPS3+fO4 S2mWXFlXPx71XHz5nxoQvjrKoNuLQubGLKjjp1Cq/J5AuSV8Vtjfo3q6h8iGrq2ZElh5P/mH f5gQldW1ye0DHuTnnkVk9zV81IPkrIsemMf8+rrBT/Fv8cYT/1zIF/jtMRyu4I04B8/cLu5I PQjQBemQpPSiaNLmJytE4w6PqerSSnnZcrR7P4abXKzcuUQ3sU8zs5x2tcrRPpdyRnjupLun U9CuM/wGe4M6TqSvxjKOp9L/Az4xnvDIBs7Az+YZyRn0nVQaYA9f9QzmjPNdRb4hn3Rn9Yz3 xnLEPtJF0ue12urzKfXz8unzezm078/h8bmPuDyqY720NV1l0+v1dHP7Wh16fYA2cd2XT0dL sKKif0c7zn4+jIu9sn0kY/bVvoU862hzuhQ6tlQIRWjO61QISVYZkHjGSEfIerH12YEefvs2 WbqU6k6ztzaecrapJnQ5n5+bYboFb6ffbkIiQpPv+xzaT9lsyn7O0p+22ak/C6Sk/LCf9Snp Y4naUVJKhWUlbvMp6USHO0MN2c7MVqKSR55XoU/iSWPNWrZGRRxsbq9TG9Xp0UUB3nwOL0qN I+34fN7fA8vEo8vn4+R0UPo1hycjIHuTUfrP7fE/tv30HXfMcajhcxD7HY+gSvPwvtPv8CBO LWxoNS1sBwAABBUAAEMJcSUAAApVVUNvZGUudHh0zPQFonOW2kcjWJp98AbToZrS3WuNIgS4 2Phjb2c105vU9bOUouVvMtt2tzLxzMvNYzxx+///u8xt9s6RAcgIIEUBQgeA5RTwIKE8BDvA e1babndClYNOj15s/QPipWJbmsmV7F1Tspo2TVqX4rVc+muZWKvxW+4n3HvbO2m4anSvc+in 9MlV59fXqZTM116ViM/pV3MDP10sYp9CpKHPXI9U7Ffo67pIWLH4Yc+Tv0ZM2VFFWja2pU9E tczET2uqVVQFKupmsQRrrdI9tDlSm0PJlL1SretF7XTROpbpVNcHhp0q10UzrerftbJtUG0E /grdRurmXSERT9rCS2UuY+8UB5c2jH98F711K30te9jlauAcS5uFTXbEhvW2ZlV5WRytZTBk EOO+Z6MXavyYE/gqVlUlLdxx5RrD5DdqeIsXTL1Bjp4YO+dfBWpiMGTat2xksYu11vrpMUNb f2I/9VeypTSabB6d5f4XnvIv+ujewTv1KyfMIKjIq1PZU/cDnpXPAIAMdXKBkXw6ZSh1lTID lUJDqMZyYZQ0+8jdDBlVQUDotggpKJQooTRR/gxY1blyeK9jDYVRQ4uZWHFUdEu1knii5RW+ E4oea5mv4GpyV00sc+bhEa0GbXRW6VFshx1rrmeYtZFbaNzEiJs+6Zk4XRFJzXCiMHC2BZkd tW5kjdbWSnQt3adGnPChjrV+qvYB7I/gOlpAmPC/JbZl6oB51qwSykkG6Tm4k4whgMhzqUzX MHdhuKlbU+luqspwSDSJwUJUs+ysxtg2PcDIDuFEwM+kANJWUqrJYEZoi/v/k9mXB7Y11Cpy T30iCvT9Cq6/fiYRadwevYX+dJ+6qiumRivSrv0Z1aMysPrwZ+o/SK2X/Dzquo2O7Tlw8b3U tSpBrtcKiWzTEvh1CRitDtHQex+0wV3LHw7bYAvwZQHlr7cEYpoLANeDiJTFabCBXtjD9+Fq QpueQ4Zcn1QseK7YydkWK4CeTguK3TLktt0uambGuuKmsjjVCuxdUGMdVIkQl28rMRw721I8 GvichydvO6fhRWKaXH6iq+sY5VJhkXkj0EtZHhVqng7YJwx58/v9Xq9SvJcwoYhhf1QofUE6 ajedXn4UDcaBWO5UCY3edAhe5CD6j+ZCsnxFZEPGYdIfnmffM+oZuarA0V22t2/9ub0XqAyg lIyTJn7aKu2MI3/jQFGIb/PKrp0+3Nix/kV0ysPBPdVRTDydkMhy6YHGINqr3bgDdSYn6q5y y4RwWlhL/c9iA6/Y4lfQVO12wzFFfS7Z0RvkDyjS1/Kn2B/lNbXHfadFiMXJr5PgDiHgjCIw +9dL+n4DVduc6zoMbthQV/unj+9OXxpzKuGdk/UX/izvniAhh3L3J8QgJ8UpwL47qKJoYhQj /5p6WOERPQOAcDmIigDZZqBTf2xe1+zEMjID/2WYjR9L5UMrdDObazbyvc2KOlPJX1yLhnQS rrgWAY1kYHS04whmFaNtM/TCqo6oQ7I+Dsu2noTfKq6mtzikVLMvY0MIpYV+W96CXdrdhPCE GxgiB5xE77qsBMscdwuSsmmaaiSGm75QOdCPnA8X6GfDM+Y1eb0s4PcQtsK/UHt43lfWGNVt ormlIFGyFm7WnAwhDMchRnBPWNUgkXU3YMVNFezafBtW+RNM6aPSs/thIuNDZouLd78Qp5oP Vz4VqWrxgqMeNfUybWrybDlY3MBIH62SdN25DPhF9EzOVUSYIeevE7JoQqUgW7NuVVRVU2y0 kcFwiuM0kWeoVjwqgtnQisMOk54p8MUoMHnpOSRzDZBMhHZc7ghlJXGRxKv+sB55rBfgX/24 D01Fw1BHgPP4ngP+GoBMB56DP+YD4vb5YD4wZ/XAfbqJ/DAfy4DBWSf+wFREn/uAqJaf/wFW wl8sBVoU/jgKhYT/jAUx39sBULUr9stccBVs0/jgKskeGArr/ngKtwE7GP44APpY/wb+0YAS 8ycLs7/C+wngPJPmVrqX6fC/Pnflsb5DhbHU+4cWJOTLZ3lhyWg6bfwGTmMiLC9ZcdkVO3TG 4poMaoK8Ro5xGY3Gu9tsWGalbh10R2+AL3dg+rwx2vsrWbHDHjPAWpB+C2FZXUbOos6MPNXP QmFe8jvTDc2qzl328uXo87VY4frcNwN4u62nfUPDgnLlPj8J+H+YPwRjoYDIvoO4lYUNzDvQ vprFKDJF1wiqznsGwRyvJgBe5TFgbwCFJDG3mKMBfhXGg5m40JUVKzPaO+qiQKeb33ddQwgL lm+SywcMfvYxMv/T2wprvjuq9l07D7fHd/pVodWo5iGbP4JTSnMezezB9arP70qygrTMwd6E fhgqAT/FNw+vHh9nhp9sU3EudyYQYkWRgorD2CfYc5aSimmvc+PO3Rm58eDFyfffTQPwR06p ay6NpEsZSJ+MrVb0PIRz348vJdwrIyx+E9d96Z7s+TRj/g6tjj/E1n+D8osWyCTDmy+GjBl0 WBilTPL+9Kk35JjF47AD6hKvzfP8969eu8V7s/ivF+JG+LB/P6PQbB6AAA== - --------------402ABD87835-- @endnode @node ID31_1 "UU Encoding (ID31_1)" Date: Tue, 17 Nov 1998 12:36:43 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: UU Encoding Gul Dukat wrote: > > Hello guys ! > > A module for doing UU (en/de)coding was requested, so > here it is. I wanted to upload it yesterday but I've > simply forgotten the disc at home (Sorry !). May I also make a wish to the fairie codemother (or is codefather ;) and have the code magically appear at my desktop the week after... 8-D - -MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID32_0 "Loudmouth v1.0 (ID32_0)" Date: Tue, 17 Nov 1998 10:21:37 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Loudmouth v1.0 Hi All, I've coded a little application Called 'Loud Mouth'. The concept is pretty easy... it simply sets-up a little public message port which waits for someone to send it a String message. Thus When using applications which need to notify you but do not have easy access Consoles (like libraries), this little marvel will fill the gap for you. It also has the advantage of SHARING ONE CONSOLE for All tasks using Loudmouth... thus you can more easily track messages from different subsystems synchronously ;) It is remotely stopped. ( I provide a little Shut_up Function and Application to help you with this). If anyone wants a copy, please mail me direct and I will prepare you a little archive in a week or so ;) - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID32_1 "Loudmouth v1.0 (ID32_1)" Date: Tue, 17 Nov 1998 15:27:24 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Loudmouth v1.0 On Tue, 17 Nov 1998, Maxim Olivier-Adlhoch wrote: =>Thus When using applications which need to notify you but do not have =>easy access Consoles (like libraries), this little marvel will fill the =>gap for you. => =>It also has the advantage of SHARING ONE CONSOLE for All tasks using =>Loudmouth... thus you can more easily track messages from different =>subsystems synchronously ;) Dare I mention what Sashimi does? Stuart @endnode @node ID32_2 "Loudmouth v1.0 (ID32_2)" Date: Tue, 17 Nov 1998 12:27:57 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Loudmouth v1.0 Stuart Caie wrote: > > On Tue, 17 Nov 1998, Maxim Olivier-Adlhoch wrote: > > =>Thus When using applications which need to notify you but do not have > =>easy access Consoles (like libraries), this little marvel will fill the > =>gap for you. > => > =>It also has the advantage of SHARING ONE CONSOLE for All tasks using > =>Loudmouth... thus you can more easily track messages from different > =>subsystems synchronously ;) > > Dare I mention what Sashimi does? Sashimie? - -MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID32_3 "Loudmouth v1.0 (ID32_3)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Tue, 17 Nov 1998 18:44:16 +0100 Subject: Re: Loudmouth v1.0 Den 17-Nov-98, skrev Stuart Caie: >On Tue, 17 Nov 1998, Maxim Olivier-Adlhoch wrote: >=>Thus When using applications which need to notify you but do not have >=>easy access Consoles (like libraries), this little marvel will fill the >=>gap for you. >=> >=>It also has the advantage of SHARING ONE CONSOLE for All tasks using >=>Loudmouth... thus you can more easily track messages from different >=>subsystems synchronously ;) >Dare I mention what Sashimi does? Or the much older Sushi? =) The greatest advantage to these packages is of course the large number of programs already supporting them (or execs debuging functions to be precise). @endnode @node ID32_4 "Loudmouth v1.0 (ID32_4)" Date: Wed, 18 Nov 1998 09:50:09 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Loudmouth v1.0 On Tue, 17 Nov 1998, Carl Drougge wrote: =>Den 17-Nov-98, skrev Stuart Caie: =>>On Tue, 17 Nov 1998, Maxim Olivier-Adlhoch wrote: =>>=>It also has the advantage of SHARING ONE CONSOLE for All tasks using =>>Dare I mention what Sashimi does? =>Or the much older Sushi? =) Or the even older than that "Reporter", or "Detective"? =>The greatest advantage to these packages is of course the large number of =>programs already supporting them (or execs debuging functions to be precise). Yes. Exec has had a 'console' since day one, but it was (and still is) private, and has to be used via debug.lib, and has had to be connected to the serial port at 9600 baud. However, Reporter, Detective, Sushi, Sashimi and MungFriend all patch the secret LVOs so the output goes other than the serial port. Sushi has bugs in it, and is not supported. Sashimi and MungFriend are both supported, and safer/newer/easier to use than the old Sushi. I prefer Sashimi for my own highly debatable reasons. Anyway, an example of a 'Console' which I use is: Run <>NIL: Sashimi CONSOLE WINDOW=VNC:///-1/Console/MENU/PROPY/ICONIFY/ICONIFIED How do programs output to it? Well, they normally link with debug.lib, E has had tools/debug.m for quite a while. How do you prepare a source to print debug messages? Like so: OPT PREPROCESS #define DEBUG -> debugging output enabled - ->#define DEBUG -> debugging output disabled (comment out #define) #ifdef DEBUG MODULE 'tools/debug' #define D(x,y) kprintf(x,y) #endif #ifndef DEBUG #define D(x,y) #endif PROC main() D('MyApp: startup: {main}=$\h arg=$\h\n',[{main},arg]) blah_blah_blah() D('MyApp: blah_blah_blah() done\n',NIL) ENDPROC Stuart @endnode @node ID32_5 "Loudmouth v1.0 (ID32_5)" Date: Wed, 18 Nov 1998 14:06:02 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Loudmouth v1.0 Stuart Caie wrote: > However, Reporter, Detective, Sushi, Sashimi and MungFriend all patch the > secret LVOs so the output goes other than the serial port. > > Sushi has bugs in it, and is not supported. Sashimi and MungFriend are both > supported, and safer/newer/easier to use than the old Sushi. I prefer Sashimi > for my own highly debatable reasons. > > Anyway, an example of a 'Console' which I use is: > > Run <>NIL: Sashimi CONSOLE WINDOW=VNC:///-1/Console/MENU/PROPY/ICONIFY/ICONIFIED > is Sashimi on Aminet? if so, where? > How do programs output to it? Well, they normally link with debug.lib, E has > had tools/debug.m for quite a while. > > How do you prepare a source to print debug messages? Like so: > > OPT PREPROCESS [...] Well, I see that its not that hard to get such a thing going... already. but Loudmouth is Command driven (and even if its still just a hatchling) I am able to extend its functionality to something more than a simple CON... Its also very easy to use... no lib to open, no special #defines, etc. all you do is put the dormant application (loudmouth) in your wbstartup. then any task which uses it will wake it up. You just have to use a module (loudm.m) which knows the protocol by using any of its dedication functions like loudm_talk('string') or loudm_shutup(). to print variables as you would with a PrintF, just use StringF and dynamically build your string... ;) I will extend Loudmouth's capabilities in time, but for now its just a shared console... - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID32_6 "Loudmouth v1.0 (ID32_6)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Fri, 20 Nov 1998 00:49:28 +0100 Subject: Re: Loudmouth v1.0 Den 18-Nov-98, skrev Maxim Olivier-Adlhoch: [About sushi-like programs] >> How do programs output to it? Well, they normally link with debug.lib, E has >> had tools/debug.m for quite a while. >> >> How do you prepare a source to print debug messages? Like so: >> >> OPT PREPROCESS >[...] >Well, I see that its not that hard to get such a thing going... already. but >Loudmouth is Command driven (and even if its still just a hatchling) I am able >to >extend its functionality to something more than a simple CON... >Its also very easy to use... no lib to open, no special #defines, etc. all >you do >is put the dormant application (loudmouth) in your wbstartup. then any task >which >uses it will wake it up. You just have to use a module (loudm.m) which knows >the >protocol by using any of its dedication functions like loudm_talk('string') or >loudm_shutup(). to print variables as you would with a PrintF, just use >StringF and >dynamically build your string... ;) And if you want to type long names you don't need any defines or libs or anything to use execs debugging either. If you like me have a genuine VT320 terminal as well you don't have to have any program running to see the output either. And debug.lib (debug.m in E) supports WriteF()-style controls without using StringF() (with kprintf()). @endnode @node ID32_7 "Loudmouth v1.0 (ID32_7)" Date: Thu, 19 Nov 1998 19:27:16 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Loudmouth v1.0 Carl Drougge wrote: > And if you want to type long names you don't need any defines or libs or > anything to use execs debugging either. If you like me have a genuine VT320 > terminal as well you don't have to have any program running to see the output > either. > And debug.lib (debug.m in E) supports WriteF()-style controls without using > StringF() (with kprintf()). Loudmouth will be getting a little more functionality than a console. Not today, not tomorrow but soon. As I said, it is a command-driven client-server debuging tool. At version 1.0 all it supports is simple Console messages. It takes about 2 mins to understand, instal and use and It will be getting Direct(stack-based) PrintF style argument passing in the next version. Possible features to come: - -------------------------- Argument Parameters overriding! It might even be used to generate Official logs and stuff like that. Replication step logger scrolleable/threaded console messages etc. It also has the advantage of being implemented by myself, so I can bend it to my will or to the will of any user which uses it. ;-) - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID32_8 "Loudmouth v1.0 (ID32_8)" Date: Fri, 20 Nov 1998 11:47:13 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Loudmouth v1.0 On Thu, 19 Nov 1998, Maxim Olivier-Adlhoch wrote: =>Possible features to come: =>-------------------------- =>Argument Parameters overriding! =>It might even be used to generate Official logs and stuff like that. =>Replication step logger =>scrolleable/threaded console messages =>etc. What it must have: atomic messages. Stuart @endnode @node ID32_9 "Loudmouth v1.0 (ID32_9)" Date: Fri, 20 Nov 1998 09:12:44 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Loudmouth v1.0 Stuart Caie wrote: > > On Thu, 19 Nov 1998, Maxim Olivier-Adlhoch wrote: > > =>Possible features to come: > =>-------------------------- > =>Argument Parameters overriding! > =>It might even be used to generate Official logs and stuff like that. > =>Replication step logger > =>scrolleable/threaded console messages > =>etc. > > What it must have: atomic messages. You mean that the memory space used to display ge string is Copied from the string memory used by the client application? - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID32_10 "Loudmouth v1.0 (ID32_10)" Date: Fri, 20 Nov 1998 14:19:57 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Loudmouth v1.0 On Fri, 20 Nov 1998, Maxim Olivier-Adlhoch wrote: =>> What it must have: atomic messages. =>You mean that the memory space used to display ge string is Copied from =>the string memory used by the client application? No, I mean that if two clients write a message at the same time, the messages do not mix with each other. Stuart @endnode @node ID32_11 "Loudmouth v1.0 (ID32_11)" Date: Fri, 20 Nov 1998 10:51:00 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Loudmouth v1.0 Stuart Caie wrote: > > On Fri, 20 Nov 1998, Maxim Olivier-Adlhoch wrote: > > =>> What it must have: atomic messages. > =>You mean that the memory space used to display ge string is Copied from > =>the string memory used by the client application? > > No, I mean that if two clients write a message at the same time, the > messages do not mix with each other. Loudmouth is MEssage/port based... so 15 apps could send me a message but Loudmouth'd still only process them one at a time in the same order they arrived (exec msg is FIFO) ;) Indirectly, any command sent to the system is also done in a synchronous way. A console Message is just one other command... hence the client/server architecture... in some way I realize this resembles the whole QNX photon system... any graphics display is a message sent to a display server... this server can reside on ANY computer on the network... its a bit like X-Windows but much more low-level and flexible. Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID33_0 "Closing Libraries built with E (ID33_0)" Date: Tue, 17 Nov 1998 12:45:53 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Closing Libraries built with E Hi all, I'm currently getting quite annoyed at the way E seems to build its libraries... I know that with Sas/C I had much more control, since I was able to define a Proc which could verify what to do when CloseLib is Called on an opened library... And I a was also able to safely implement a hack making my library safe to close even if A task still has it 'opened'. (Which has not been able to close it) but is frozen because of a loop or some other flow error... I used to open the library, call a function named SafeHack() which I implemented into freeing ALL resources opened by this library and then set the open counter to 1 BEFORE returning... thus when the task actually calls CloseLib() it makes the library accessible for an Avail Flush... But E doesn't and really does a good job of ignoring the OpenCount for its evaluation of if it should be de-allocatable... Can someone tell me how I can Force the Library to close itself forever so I do not have to Reboot my damn computer every I run a new pass of my library... which sometimes is the CAUSE of the failing loop construct in the first place... you see I'm not to keen on seeing my HD scrape for 10 seconds strait when the system boots because its loading bg images, wbstartup stuff as well as the fonts and all the ordinary stuff... Its also a VERY long process to debug... - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID33_1 "Closing Libraries built with E (ID33_1)" Date: Tue, 17 Nov 1998 17:07:20 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Closing Libraries built with E Maxim Olivier-Adlhoch wrote: > > Hi all, > > I'm currently getting quite annoyed at the way E seems to build its > libraries... [...] Sorry If my last e-mail was aggressive at E... please don't flame me or tell how much better E is than this or that.. I already know pretty much... But I'd still like some tips if any of you know how I can cause opened libs to be forcefully 'destroyed'... - -MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID33_2 "Closing Libraries built with E (ID33_2)" Date: Thu, 19 Nov 1998 12:22:11 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Closing Libraries built with E Maxim Olivier-Adlhoch wrote: > > Maxim Olivier-Adlhoch wrote: > > But I'd still like some tips if any of you know how I can cause opened libs to be > forcefully 'destroyed'... um, still no replies on this one... did I hit a softspot ? btw, Can any confirm to me that the OS command 'avail flush' should be de-allocating opened (and dormant) libraries... I find it a bit weird to do an AllocMem(10000000, NIL) on a machine... I fear, one day, memory quantity will not be an issue.... ; should it be typed 'avail FLUSH' or is another switch missing like 'avail FLUSH ALL' or something like that? I am able to free libs in memory with the AllocMem 'trick' but I have not tried to set Library.opencount to 1 just before closing it and performing an AllocMem. I was trying with 'avail flush' and it never worked... not even for all other libs. (I'm using sysinfo to detect which libraries are still dormant on my computer) - -MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID33_3 "Closing Libraries built with E (ID33_3)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Thu, 19 Nov 1998 23:21:55 +0100 Subject: Re: Closing Libraries built with E Den 17-Nov-98, skrev Maxim Olivier-Adlhoch: >I know that with Sas/C I had much more control, since I was able to >define a Proc which could verify what to do when CloseLib is Called on >an opened library... And I a was also able to safely implement a hack >making my library safe to close even if A task still has it 'opened'. >(Which has not been able to close it) but is frozen because of a loop or >some other flow error... With Sas/C you also had more work. =) Well, I think EC should have more options for libraries too. >I used to open the library, call a function named SafeHack() which I >implemented into freeing ALL resources opened by this library and then >set the open counter to 1 BEFORE returning... thus when the task >actually calls CloseLib() it makes the library accessible for an Avail >Flush... >But E doesn't and really does a good job of ignoring the OpenCount for >its evaluation of if it should be de-allocatable... Well, so do it all yourself: Remove() the library from the system. FreeMem( libbase - libbase.negsize , libbase.negsize + libbase.possize ) This doesn't free everything no, but a little memoryloss for the sake of debugging isn't too bad, now is it? @endnode @node ID33_4 "Closing Libraries built with E (ID33_4)" Date: Thu, 19 Nov 1998 19:14:33 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Closing Libraries built with E Carl Drougge wrote: > > Den 17-Nov-98, skrev Maxim Olivier-Adlhoch: > > >I know that with Sas/C I had much more control, since I was able to > >define a Proc which could verify what to do when CloseLib is Called on > >an opened library... And I a was also able to safely implement a hack > >making my library safe to close even if A task still has it 'opened'. > >(Which has not been able to close it) but is frozen because of a loop or > >some other flow error... > > With Sas/C you also had more work. =) Agreed, yet more candy ;) > Well, I think EC should have more options for libraries too. Yeah, Like having the option to make the library safe to open more than once... even if it means that the library's global data is Shared ... I would not mind loosing exceptions and the like if it would make the library into a 'more standard system... there's more to it than meets the eye, of course, but it WOULD be nice ;) > Well, so do it all yourself: > > Remove() the library from the system. > FreeMem( libbase - libbase.negsize , libbase.negsize + libbase.possize ) > I have 16Megs of Ram... I do not think 50k of code will do much difference... the problem is that it is set somewhere as being loaded anyways...it is still in the exec's lists... actually removing the library in such a way is probably a sure way to crash your system... as the nest time it will allocate memory it will start writing over your library and ... you know what that can do ;-) > This doesn't free everything no, but a little memoryloss for the sake of > debugging isn't too bad, now is it? Its not the memory, its the Fact that it must be removed from the system's list of Libraries, otherwise it does not Reload a new version of the library into memory and I have to reboot for it to load the new version! I'd like to know HOW to remove it from the Internal list of loaded libraries...(I guess its in Exec) - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID33_5 "Closing Libraries built with E (ID33_5)" Date: Fri, 20 Nov 1998 09:30:59 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Closing Libraries built with E > should it be typed 'avail FLUSH' or is another switch missing like 'avail FLUSH > ALL' or something like that? Avail Flush is right. However it *may* free resources that are not currently allocated. Note the may, as it is should be invoked many times to be sure all resources currently not locked to be freed. > (I'm using sysinfo to detect which libraries are still dormant on my computer) If those libraries are allocated and used only by your program all it's required is to check for memory usage. I use Mamminister to see if all the memory my program has allocated is freed once it exits. It can snap and flush memory just by pressing two buttons. That may be handy in this situation. For a library to be flushed it has to have the opencount set to 0. Otherwise it is still locked by some other process. M&F @endnode @node ID33_6 "Closing Libraries built with E (ID33_6)" Date: Fri, 20 Nov 1998 11:45:09 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Closing Libraries built with E On Thu, 19 Nov 1998, Maxim Olivier-Adlhoch wrote: =>> But I'd still like some tips if any of you know how I can cause opened libs to be =>> forcefully 'destroyed'... =>um, still no replies on this one... did I hit a softspot ? It's very very dangerous to flush out code while someone is still using it. =>btw, Can any confirm to me that the OS command 'avail flush' should be =>de-allocating opened (and dormant) libraries... I find it a bit weird to do an =>AllocMem(10000000, NIL) on a machine... I fear, one day, memory quantity will not =>be an issue.... ; Not with the current AmigaOS - it's like expecting MS-DOS 5.0 to cope with the year 2000. It can't and never will - but it will be replaced with something that can by anyone who cares about their computer working. Yes, the 'garbage collector' in AmigaOS is only sprung officially into action when an AllocMem()/etc fails for the first time. You can have the same effect by allocating one more byte than the largest block (although that may become available between the Avail and the Alloc) =>should it be typed 'avail FLUSH' or is another switch missing like 'avail FLUSH =>ALL' or something like that? It's up to the library itself whether it wants to go or not, and can certainly deny the system from freeing it - the system simply calls its Expunge() routine. You can free the memory allocated for the header, and remove it from the libraries list - but you can't remove its segments (because that data is not stored in a standard place, and you can't capture it by patching) and you can't remove any allocations the library itself has made. You really do have to call Expunge() to get a library out of memory, and you really can't do anything if it doesn't want to go. Stuart @endnode @node ID33_7 "Closing Libraries built with E (ID33_7)" Date: Fri, 20 Nov 1998 09:24:48 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Closing Libraries built with E Stuart Caie wrote: > > On Thu, 19 Nov 1998, Maxim Olivier-Adlhoch wrote: > > =>> But I'd still like some tips if any of you know how I can cause opened libs to be > =>> forcefully 'destroyed'... > > =>um, still no replies on this one... did I hit a softspot ? > > It's very very dangerous to flush out code while someone is still using it. Yeah but since I'm building the library, I know what is happening and why its not running... so I also know that only one task is using it ;) > > =>btw, Can any confirm to me that the OS command 'avail flush' should be > =>de-allocating opened (and dormant) libraries... I find it a bit weird to do an > =>AllocMem(10000000, NIL) on a machine... I fear, one day, memory quantity will not > =>be an issue.... ; > > Not with the current AmigaOS - it's like expecting MS-DOS 5.0 to cope with the > year 2000. It can't and never will - but it will be replaced with something > that can by anyone who cares about their computer working. > > Yes, the 'garbage collector' in AmigaOS is only sprung officially into action > when an AllocMem()/etc fails for the first time. You can have the same effect > by allocating one more byte than the largest block (although that may become > available between the Avail and the Alloc) Well avail flush called three times still does not remove my libs, but the above allomem does... > > =>should it be typed 'avail FLUSH' or is another switch missing like 'avail FLUSH > =>ALL' or something like that? > > It's up to the library itself whether it wants to go or not, and can certainly > deny the system from freeing it - the system simply calls its Expunge() > routine. Can I call it myself within a debugging toll for example?, what is the LVO offset for it (as I'm pretty sure I can't use it in normal e syntax) > > You can free the memory allocated for the header, and remove it from the > libraries list And where would the libraries list be? >- but you can't remove its segments (because that data is not > stored in a standard place, and you can't capture it by patching) and you can't > remove any allocations the library itself has made. with 16 MB RaM in a debugging state, I'm not concerned about memory leaks, I'm more concerned about the system being in an unstable state. So If know how to trick the OS into thinking that the library is not in memory (I actually would not de-allocate it to be sure nothing crashes...) then I can ask the OS to opend a new version of it for me ;) in ALL SAFETY... > > You really do have to call Expunge() to get a library out of memory, and you > really can't do anything if it doesn't want to go. But If its been removed from the exec list, Nothing gets unstable right? - -MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID33_8 "Closing Libraries built with E (ID33_8)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Fri, 20 Nov 1998 19:18:00 +0100 Subject: Re: Closing Libraries built with E Den 20-Nov-98, skrev Maxim Olivier-Adlhoch: >> Well, so do it all yourself: >> >> Remove() the library from the system. >> FreeMem( libbase - libbase.negsize , libbase.negsize + libbase.possize ) >> >I have 16Megs of Ram... I do not think 50k of code will do much difference... >the >problem is that it is set somewhere as being loaded anyways...it is still in >the >exec's lists... actually removing the library in such a way is probably a sure >way >to crash your system... as the nest time it will allocate memory it will start >writing over your library and ... you know what that can do ;-) As long as noone is actually trying to use it it's not a problem. If you worry that someone is you can skip the freemem bit and just remove it, and that won't be a problem either. Just: Forbid() Remove( libbase.ln ) Permit() And the library is gone. If someone tries to open a library of that name none is found and it will be reloaded from disk. This is exactly what the Expunge() does if it does decide to remove the library. Expunge is if I remember correctly at offset -18, but you don't need it. Calling it has no effect if the library is open. @endnode @node ID33_9 "Closing Libraries built with E (ID33_9)" Date: Fri, 20 Nov 1998 15:51:29 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Closing Libraries built with E Carl Drougge wrote: > As long as noone is actually trying to use it it's not a problem. If you worry > that someone is you can skip the freemem bit and just remove it, and that > won't be a problem either. Just: > > Forbid() > Remove( libbase.ln ) > Permit() > > And the library is gone. If someone tries to open a library of that name none > is found and it will be reloaded from disk. This is exactly what the Expunge() > does if it does decide to remove the library. > > Expunge is if I remember correctly at offset -18, but you don't need it. > Calling it has no effect if the library is open. Thanks, I did not think the libbase was an inherited class of ln... should have checked it out in my C includes... Thanks... I was waiting for this bit ever since my first post ;) - -Maxim Now we can stop this thread... I've got my answer ;) - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID33_10 "Closing Libraries built with E (ID33_10)" From: M.Tjoelker@nl.cis.philips.com (Menno Tjoelker) Subject: Re[2]: Closing Libraries built with E Date: Sat, 21 Nov 98 23:53:48 -0100 Carl Drougge wrote about Re: Closing Libraries built with E: > As long as noone is actually trying to use it it's not a problem. If you = worry > that someone is you can skip the freemem bit and just remove it, and that= > won't be a problem either. Just: > Forbid() > Remove( libbase.ln ) > Permit() > And the library is gone. If someone tries to open a library of that name = none > is found and it will be reloaded from disk. This is exactly what the Expu= nge() > does if it does decide to remove the library. > Expunge is if I remember correctly at offset -18, but you don't need it. > Calling it has no effect if the library is open. This is not a safe method as the library will be Remove()d another time when it is removed from memory. I don't know what will happen, but it could= cause Enforcer hits or crashes. Another way to make a library inaccessible is overwriting its name: Forbid() libbase:=3DFindName(sysbase.liblist,'xxx.library') AstrCopy(libbase.ln.name+StrLen(libbase.ln.name-7),'flushed') Permit() Jilles Tjoelker - -- - --- Jilles Tjoelker | Craterlaan 6 | Tel. : +31.40.2427420 5632 AG Eindhoven | Fax : +31.40.2427420 (on request) The Netherlands | *** Author of Iris (mailer), Activity (activity meter), *** *** Select_Host (NapsaTerm frontend), Solitaire (WB game), *** *** Metronome (tool for musicians), etc. *** @endnode @node ID33_11 "Closing Libraries built with E (ID33_11)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Sun, 22 Nov 1998 22:22:36 +0100 Subject: Re: Re[2]: Closing Libraries built with E Den 22-Nov-98, skrev Menno Tjoelker: >Carl Drougge wrote about Re: Closing Libraries built with E: >> As long as noone is actually trying to use it it's not a problem. If you >worry >> that someone is you can skip the freemem bit and just remove it, and that >> won't be a problem either. Just: >> Forbid() >> Remove( libbase.ln ) >> Permit() >> And the library is gone. If someone tries to open a library of that name >none >> is found and it will be reloaded from disk. This is exactly what the >Expunge() >> does if it does decide to remove the library. >> Expunge is if I remember correctly at offset -18, but you don't need it. >> Calling it has no effect if the library is open. >This is not a safe method as the library will be Remove()d another time >when it is removed from memory. I don't know what will happen, but it could >cause Enforcer hits or crashes. Another way to make a library inaccessible >is overwriting its name: > Forbid() > libbase:=FindName(sysbase.liblist,'xxx.library') > AstrCopy(libbase.ln.name+StrLen(libbase.ln.name-7),'flushed') > Permit() Not on *any* library no. But a library which: 1. Is opened by at least one task 2. Will never be closed 3. Will never be called again In this case it *is* safe to do as I suggested, and that was the case for him. @endnode @node ID33_12 "Closing Libraries built with E (ID33_12)" Date: Mon, 23 Nov 1998 17:45:12 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Re[2]: Closing Libraries built with E Carl Drougge wrote: > > Forbid() > > libbase:=FindName(sysbase.liblist,'xxx.library') > > AstrCopy(libbase.ln.name+StrLen(libbase.ln.name-7),'flushed') > > Permit() BOTH ARE SAFE! > > Not on *any* library no. But a library which: > 1. Is opened by at least one task > 2. Will never be closed > 3. Will never be called again > > In this case it *is* safe to do as I suggested, and that was the case for him. The morale of this thread was... IF YOU ARE PROTOTYPING A LIBRARY AND HAVE ENOUGH MEMORY FOR LIBRARY REDUNDANCY... Like all the Wintel shit... Once the lib is opened... RIGHT AFTER... just Remove() it .... No library I know of gets deallocated automatically when they are closed and the counter is at 0. they stay linked and dormant. Thus if you unlink it and then Close It... it will simply become a memory leak... but it is a 'controled' memory leak. once you are satisfied with the library, simply remove the Remove(librarybase.ln) instruction and your application remains clean. Also note that the above method does NOT make your library invalid. The library is always Sane because it is your prototyping APPLICATION which is Removing() it from the list. I'm trying this tonight and I'll get back to all of you to tell you if simply Removing() it will be crash-proof. - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID34_0 "Little ARexx port shutdown query (ID34_0)" From: Chris.S.Handley@btinternet.com ("Chris S Handley") Date: 17 Nov 98 23:18:16 +0000 Subject: Little ARexx port shutdown query Question: Does anyone know how to find-out the port name OR port pointer for the sender of a message recieved using GetMsg()? Extra info: This is so I can avoid replying to a message sent to myself - unless I can do this, the following bit of code... Forbid() WHILE msg:=GetMsg(hostport) DO ReplyMsg(msg) Permit() ..will freeze the machine, because it appears to infinite-loop - presumably replying to it's own reply, and so on, forever! BTW, I can kludge this to work by (i)exiting the loop after so many iterations, and (ii)if I remember the pointer of the message I last sent, I _may_ avoid replying to myself. But this is really inefficient - and could well fail with some OS update if it doesn't like the Forbid being on for too long (perhaps due to PPC message handling say). Other than that, ARexxComm seems to work fine now - it's even OO, and just has left a few small enhancements that could be made... BTW, would anyone be interested in testing it? Thanks - -- Chris S Handley, BEng(Hons) - EMAIL: Chris.S.Handley@btinternet.com an Electronic Engineer (plus an overworked PowerAmiga nut & Anime fan) - ---------------------------------------------------------------------- "One of the laws of nature," Gorden said, "is that half the people have got to be below average". "For a Gaussian distribution, yeah," Cooper said. "Sad though." [amusing except from Gregory Benford's book Timescape] @endnode @node ID34_1 "Little ARexx port shutdown query (ID34_1)" Date: Tue, 17 Nov 1998 17:36:45 -0800 From: dobes@mindless.com (Dobes Vandermeer) Subject: Re: Little ARexx port shutdown query Chris S Handley wrote: > > Question: > Does anyone know how to find-out the port name OR port pointer for > the sender of a message recieved using GetMsg()? Well, you can get the "reply port", which may or may not be the port the message was sent from. Otherwise, you should keep in mind that messages are not sent FROM ports, so there is no way the PutMsg() could include a port. > Extra info: > This is so I can avoid replying to a message sent to myself - unless I > can do this, the following bit of code... > > Forbid() > WHILE msg:=GetMsg(hostport) DO ReplyMsg(msg) > Permit() Set the replyport in the message you SEND to yourself to NIL. That will prevent ReplyMsg from sending the message back. CU Dobes @endnode @node ID34_2 "Little ARexx port shutdown query (ID34_2)" Date: Wed, 18 Nov 1998 12:37:18 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Little ARexx port shutdown query On Tue, 17 Nov 1998, Dobes Vandermeer wrote: > Chris S Handley wrote: > > > > Question: > > Does anyone know how to find-out the port name OR port pointer for > > the sender of a message recieved using GetMsg()? > > Well, you can get the "reply port", which may or may not be the port the > message was sent from. Otherwise, you should keep in mind that messages > are not sent FROM ports, so there is no way the PutMsg() could include a > port. It would be better to check the type of the message you have received (msg.ln.type). If it is a NT_REPLY message then you have NOT to reply it (this is a general rule). I don't know how ReplyMsg() behaves if no replying port is specified in the message, but that seems to be another good solution (if it works) as stated below. > > Extra info: > > This is so I can avoid replying to a message sent to myself - unless I > > can do this, the following bit of code... > > > > Forbid() > > WHILE msg:=GetMsg(hostport) DO ReplyMsg(msg) > > Permit() > > Set the replyport in the message you SEND to yourself to NIL. That will > prevent ReplyMsg from sending the message back. Once your program has sent the command, to know about it it must be in a wait() procedure. This means here the program MUST check which kind of message it has received, and, not answering to the NT_REPLY messages it will simply remove them from the list queue before closing the port. I should add then when answering messages that are not owned by our task the NY_REPLY type must be inserted in the msg.ln.type. I have created a quite complex but efficient way to handle Arexx messages for my BAH program, but I really can't remember here the details. Once at home I will have a look at the sources to see how I managed to handle reply messages. Last solution is to create another private message port where you are going to send yourself all the messages you need. This way you know that all messages that are received by that port do no need a reply (they are already your own). M&F @endnode @node ID34_3 "Little ARexx port shutdown query (ID34_3)" Date: Wed, 18 Nov 1998 14:15:05 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Little ARexx port shutdown query Chris S Handley wrote: > > Question: > Does anyone know how to find-out the port name OR port pointer for > the sender of a message recieved using GetMsg()? VERY SIMPLE... if the reply port of your message is the same as your port used for receiving messages! When building messages, it is an almost absolute neccessity for you to properly setup a replyport, otherwise you will never know when another task has finished with your message. thus if you recive a mail at your port which has a replyport setup to your port, simply ignore it and move on to the next. you might also want to make a port used for 'receiving', and check if the replyport is your other 'send' port. if you are not using replyports, well, I wonder how you are handling messages... I hope the above makes sense to you... if not just explain what you do not understand... I'll go deeper. - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID34_4 "Little ARexx port shutdown query (ID34_4)" From: Chris.S.Handley@btinternet.com ("Chris S Handley") Date: 19 Nov 98 00:03:48 +0000 Subject: Re: Little ARexx port shutdown query Before dying of envy of Chris's Amiga Dobes Vandermeer was able to say: > Chris S Handley wrote: > > > > Question: > > Does anyone know how to find-out the port name OR port pointer for > > the sender of a message recieved using GetMsg()? > > Well, you can get the "reply port", which may or may not be the port the As I don't have any docs - how do I access this Reply port? For instance, given "rexxmsg:=GetMsg(hostport)", I know I can access the item "rexxmsg.mn.ln.type". > > Extra info: > > This is so I can avoid replying to a message sent to myself - unless I > > can do this, the following bit of code... > > > > Forbid() > > WHILE msg:=GetMsg(hostport) DO ReplyMsg(msg) > > Permit() > > Set the replyport in the message you SEND to yourself to NIL. That will > prevent ReplyMsg from sending the message back. Thats a nice idea (noticing you are sending it to yourself before sending it & so doing something to the message) - but I need to know what object this replyport is stored in! - -- Chris S Handley, BEng(Hons) - EMAIL: Chris.S.Handley@btinternet.com an Electronic Engineer (plus an overworked PowerAmiga nut & Anime fan) - ---------------------------------------------------------------------- One proud owner of a Risc 240MHz PowerPC 603e, 66MHz bus, 32Mb 60ns RAM, DMA Fast SCSI-II (10Mb/s), Gbs of HD, SyQuest 230Mb removable drive, CD drive, Multi-Sync monitor... all attached to an *AMIGA* :-) @endnode @node ID34_5 "Little ARexx port shutdown query (ID34_5)" From: Chris.S.Handley@btinternet.com ("Chris S Handley") Date: 19 Nov 98 00:31:32 +0000 Subject: Re: Little ARexx port shutdown query Before dying of envy of Chris's Amiga mauro fontana was able to say: > On Tue, 17 Nov 1998, Dobes Vandermeer wrote: > > Chris S Handley wrote: > > > Question: > > > Does anyone know how to find-out the port name OR port pointer for > > > the sender of a message recieved using GetMsg()? > > > > Well, you can get the "reply port", which may or may not be the port the > > message was sent from. Otherwise, you should keep in mind that messages > > are not sent FROM ports, so there is no way the PutMsg() could include a > > port. > > It would be better to check the type of the message you have received > (msg.ln.type). If it is a NT_REPLY message then you have NOT to reply it > (this is a general rule). I don't know how ReplyMsg() behaves if no > replying port is specified in the message, but that seems to be another > good solution (if it works) as stated below. Ah, thats an even better idea, but I have some questions: 1.When is NT_REPLY set automatically? Just when using ReplyMsg()? 2.So, I assume I may alter msg.ln.type myself, right? 3.Out of interest, what other values can it take? > > > Extra info: > > > This is so I can avoid replying to a message sent to myself - unless I > > > can do this, the following bit of code... > > > > > > Forbid() > > > WHILE msg:=GetMsg(hostport) DO ReplyMsg(msg) > > > Permit() > > > > Set the replyport in the message you SEND to yourself to NIL. That will > > prevent ReplyMsg from sending the message back. > > Once your program has sent the command, to know about it it must be in a > wait() procedure. This means here the program MUST check which kind of > message it has received, and, not answering to the NT_REPLY messages it > will simply remove them from the list queue before closing the port. Thanks for spotting this bug which I have inherited from the original source I based my work on. If ReplyMsg() sets NT_REPLY, then my problems are solved! > I should add then when answering messages that are not owned by our task > the NY_REPLY type must be inserted in the msg.ln.type. > I have created a quite complex but efficient way to handle Arexx messages > for my BAH program, but I really can't remember here the details. Once at > home I will have a look at the sources to see how I managed to handle > reply messages. That would be very interesting, maybe even very useful. > Last solution is to create another private message port where you are > going to send yourself all the messages you need. This way you know that > all messages that are received by that port do no need a reply (they are > already your own). My whole problem is the user is just using some (OO) methods to send/recieve arexx messages - and it ought to be perfectly valid to be able to send messages to yourself (unlikely I know)... Maybe you can answer another question on rexx? How do I find out how many arguments (0 to 16) are in the the rexxmsg.args[] structure? Something to do with the "action field" (rexxmsg.action?) ?! - -- Chris S Handley, BEng(Hons) - EMAIL: Chris.S.Handley@btinternet.com an Electronic Engineer (plus an overworked PowerAmiga nut & Anime fan) - ---------------------------------------------------------------------- One proud owner of a Risc 240MHz PowerPC 603e, 66MHz bus, 32Mb 60ns RAM, DMA Fast SCSI-II (10Mb/s), Gbs of HD, SyQuest 230Mb removable drive, CD drive, Multi-Sync monitor... all attached to an *AMIGA* :-) @endnode @node ID34_6 "Little ARexx port shutdown query (ID34_6)" From: Chris.S.Handley@btinternet.com ("Chris S Handley") Date: 19 Nov 98 00:30:51 +0000 Subject: Re: Little ARexx port shutdown query Before dying of envy of Chris's Amiga Maxim Olivier-Adlhoch was able to say: > Chris S Handley wrote: > > Question: > > Does anyone know how to find-out the port name OR port pointer for > > the sender of a message recieved using GetMsg()? > VERY SIMPLE... if the reply port of your message is the same as your port used > for receiving messages! As I said to someone else: How to I find out the reply port? I am looking for an answer like "rexxmsg.mn.ln.type" perhaps with references to what calls produce the data object. Most important: Also, how do I find my port? Is it just the parameter I give to (for example) "GetMsg(hostport)"? > When building messages, it is an almost absolute neccessity for you to > properly setup a replyport, otherwise you will never know when another task > has finished with your message. thus if you recive a mail at your port which > has a replyport setup to your port, simply ignore it and move on to the next. > you might also want to make a port used for 'receiving', and check if the > replyport is your other 'send' port. Naah, my whole problem is letting the user send messages to himself. > if you are not using replyports, well, I wonder how you are handling > messages... I believe that is what I am doing, but I am really just using a massively tidied-up version of someone else's code. Here's the bit used to send a message: - ---cut--- listnode:=hostport.ln IF (rexxmsg:=CreateRexxMsg(hostport,'rexx',listnode.name))=NIL THEN RETURN NIL rexxargs:=rexxmsg.args IF argstring:=CreateArgstring(command,StrLen(command)) rexxargs[0]:=argstring rexxmsg.action:=RXCOMM OR flags rexxargs[15]:=unknownmsg Forbid() IF (targetport:=FindPort(targetname)) THEN PutMsg(targetport,rexxmsg) Permit() IF targetport self.unconfirmed:=self.unconfirmed+1 RETURN rexxmsg ENDIF ELSE - ---cut--- I assume CreateRexxMsg() automatically sets a reply port, as code elsewhere waits for a NT_REPLYing message (which it can then decrease the unconfirmed count). > I hope the above makes sense to you... if not just explain what you do not > understand... I'll go deeper Maybe you can answer another question on rexx? How do I find out how many arguments (0 to 16) are in the the rexxmsg.args[] structure? Something to do with the "action field" (rexxmsg.action?) ?! Thanks - -- Chris S Handley, BEng(Hons) - EMAIL: Chris.S.Handley@btinternet.com an Electronic Engineer (plus an overworked PowerAmiga nut & Anime fan) - ---------------------------------------------------------------------- Windows95: noun, 32 bit extensions and a graphical shell for a 16 bit patch to an 8 bit operating system originally coded for a 4 bit microprocessor, written by a 2 bit company, that can't stand 1 bit of competition. [source: John Girvin] Synonyms: Plug'n'Pay, MacintoshOS'85, Winblows, Windoze94.99998, ... @endnode @node ID34_7 "Little ARexx port shutdown query (ID34_7)" Date: Fri, 20 Nov 1998 14:48:18 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Little ARexx port shutdown query > My whole problem is the user is just using some (OO) methods to > send/recieve arexx messages - and it ought to be perfectly valid to be > able to send messages to yourself (unlikely I know)... > > Maybe you can answer another question on rexx? How do I find out how > many arguments (0 to 16) are in the the rexxmsg.args[] structure? > Something to do with the "action field" (rexxmsg.action?) ?! On the RKRM Libraries there is very little about Arexx, Arexx messages and Arexx ports. I just know the essential that have allowed me to create my Arexx utility thanks also to Marco Negri (Blacks Editor author) that has helped me a lot. However, if you can wait till monday (I'm going home in few minutes) I'll spot everything I can from RKRM manual and my Arexx code to give you a description on how OS function works and should be used. Of course as complete as I know. However, if I remember right, NT_REPLY is automatically set by ReplyMsg() function so no direct access to msg.mn.ln.type is needed. You just have to check for it before answering not only your own messages but every one. As you have experienced if you ignore that case, you can eneter an infinite loop. The idea of the reply message is to give message owning to the sender again. You already know that sent messages cannot be modified till they are marked as NT_REPLY by the receiver, thus signaling it has used it and it does not need it anymore. There's no sense in sending to him the message again as it (if written correctly) would just reply it as soon as it receive it as it is already marked as NT_REPLY. About the number of arguments, I can't remember (or better, don't know myself if I know about that), so I'll go and see any info about it. M&F @endnode @node ID34_8 "Little ARexx port shutdown query (ID34_8)" Date: Fri, 20 Nov 1998 13:27:26 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Little ARexx port shutdown query eferences: Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Chris S Handley wrote: > > Before dying of envy of Chris's Amiga Maxim Olivier-Adlhoch was able to say: > As I said to someone else: How to I find out the reply port? I am > looking for an answer like "rexxmsg.mn.ln.type" perhaps with > references to what calls produce the data object. the answer to your question is included in the tutorial... I will explain exactly how EXEC messaging works... This is aimed for beginners (I'm not hinting you are a beginner, but since you do not seem to have the RKM's you might not have the whole picture...) IT is a very simplistic approach to understanding Exec Messaging. I also include a little Metaphor which surprisingly is very conscise... Please do not be insulted that I have made this little 'tutorial' as a reply to your questions... I just tough it was in context and this type of question pops-up often I find... AREXX is just a PROTOCOL (or you could call it an inherited class) using exec. Here we go... THE MESSAGE PORT... (Thus receiving a message) - -------------------- 1- a signal bit is reserved. (This is like a little doorbell which tells your system to respond) it is set every time a message arrives. When a message arrives, it IS possible that the signal is ALREADY set (someone else buzzing the door) so your task is not aware of this new message... yet. 2- a Message Port is Allocated (This like the door to which the doorbell is associated.) when a message arrives, he sets the signal to on, so then you must go to the door, and open it to see if someone is there... 3- Get a Message (you answer to the first person in front of the door) Here you GetMsg() to the first message waiting on the Port's list. exec message is FIFO (First In First Out) this message is also REMOVED from the port's message list... so don't loose your pointer... 4- You Handle the MEssage (You discuss, have tea, shoot the person in the head ;) Here is where you actually interact with the message's information. You can handle it anyway you want but you should make this as fast as possible. 5- You reply... (you say "goodbye, hope you have a nice trip back" the person looks at the map in his hands and goes to another door...with a big red cross on his map) Here you will use ReplyMsg(). What happens here is simple. I am not sure if NT_REPLY is automatically set by ReplyMsg (I do not have my RKMs with me at work...) but this is where it should be done. IF the actuall MESSAGE had a reply port setup in its structure it will SendMsg() to it. I'll explain more in SENDING A MESSAGE... 6- Next! (you check if there is someone else at the door.. ) simply, a new iteration through your loop (do 3-5 until 7 occurs) 7- No One left... (There is no one left at the door... I'm going back to doin nothing... like watching TV) Here you go back to Wait() or WaitPort() state. (usually this is also a loop of some kind) SENDING A MESSAGE - ------------------- 1- You allocate it (the litle new born is delivered... still innocent and dumb) You reserve reserve memory space for your message structure. 2- You Initialize it (The child becomes an adult as he understand what is his missin in life and what is his goal) Here you simply set the various fields of your structure. 2.a- You give it a reply port address... (the Adult buys himself a house where he knows he'll always be safe). IF you have allocated a port in the Sending Application, You SHOULD set it in the msg.replyport field of your message... the exact syntax is probably wrong (Just so a ShowModule on the mn OBJECT and you'll see it). Then the port will be able to tell you where to go back when you're finished in your duty. 3. Find the port to go to... (You hand out a map to your guy so he know where to go) Simply do a FindPort() if it is public port and then it is good habit to do a Forbid/Permit Pair if you cannot be guaranteed that the port will be valid when next step occurs... 4. Send the MEssage you set off on your journey walking along until you end up at the destination adrress and Door... which you press on the doorbell ;) you simply call SendMsg() on it ... continue to MESSAGE PORTS In your case, simply ALWAYS set your mn.replyport when you send a message.... in fact Everybody should implement this all the time... otherwise you cannot know if the other task has finished with your message... This is a simple guide for beginners to understand Exec Message Passing. AREXX uses the same system (internally) but with a dedicated Message structure. To know how big or the number of arguments, I'd tell you to snoop the various modules involved with the actuall messaging... The Arexxmessage structure will tell you, otherwise I really do not know. > I believe that is what I am doing, but I am really just using a > massively tidied-up version of someone else's code. Here's the bit > used to send a message: > > ---cut--- > listnode:=hostport.ln > IF (rexxmsg:=CreateRexxMsg(hostport,'rexx',listnode.name))=NIL THEN RETURN NIL > rexxargs:=rexxmsg.args > > IF argstring:=CreateArgstring(command,StrLen(command)) > rexxargs[0]:=argstring > rexxmsg.action:=RXCOMM OR flags > rexxargs[15]:=unknownmsg > > Forbid() > IF (targetport:=FindPort(targetname)) THEN PutMsg(targetport,rexxmsg) > Permit() > > IF targetport > self.unconfirmed:=self.unconfirmed+1 > RETURN rexxmsg > ENDIF > ELSE > ---cut--- > > I assume CreateRexxMsg() automatically sets a reply port, Just check if the message included in rexxmsg includes a mn.replyport pointer = to your hostport... > Maybe you can answer another question on rexx? How do I find out how > many arguments (0 to 16) are in the the rexxmsg.args[] structure? > Something to do with the "action field" (rexxmsg.action?) ?! I'm not very Skilled in AREXX specifics myself... yet MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID34_9 "Little ARexx port shutdown query (ID34_9)" Date: Mon, 23 Nov 1998 13:05:40 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Little ARexx port shutdown query > 5- You reply... (you say "goodbye, hope you have a nice trip back" the > person looks at the map in his hands and goes to another door...with a > big red cross on his map) Here you will use ReplyMsg(). What happens > here is simple. I am not sure if NT_REPLY is automatically set by > ReplyMsg (I do not have my RKMs with me at work...) but this is where it > should be done. IF the actuall MESSAGE had a reply port setup in its > structure it will SendMsg() to it. I'll explain more in SENDING A > MESSAGE... I have looked at my RKM and the result is yes: ReplyMsg() automatically sets NT_REPLYMSG (<- right flag spelling). Messages that have to be answered are those that contain NT_MESSAGE set in their ln.type field. This is automatically set by PutMsg(). The other last option NT_UNKNOWN should not be answered. > 4. Send the MEssage you set off on your journey walking along until you > end up at the destination adrress and Door... which you press on the > doorbell ;) you simply call SendMsg() on it ... continue to MESSAGE > PORTS That should be PutMsg() > This is a simple guide for beginners to understand Exec Message Passing. > AREXX uses the same system (internally) but with a dedicated Message > structure. To know how big or the number of arguments, I'd tell you to > snoop the various modules involved with the actuall messaging... The > Arexxmessage structure will tell you, otherwise I really do not know. I think there are not ways to know how many "slots" in the Arexx message are used. But this is not a problem. You can just check them all to know if they contain something useful. However the command parameters are stored in the arg[0] together with the command name. You have to parse the cmmand with ReadArgas() or ReadItem() functions o know what are the options (if available) of the command you have received. This may help you somehow, but maybe you already know this: To delete an Arexx message once it has returned from the remote hosrport use: DeleteArsString(msg.result2) ClearRexxMsg(msg, 16) -> This clears all the 16 slots DeleteRexxMsg(msg) msg.result1 is always a value that contains a return value msg.result2 is always a pointer to a string that may returns the anwer of the command. To have valid results in those fields you have to set the RXFF_RESULT flag in your Arexx message before you sent it to the host. Hope this is going to help you. M&F @endnode @node ID34_10 "Little ARexx port shutdown query (ID34_10)" From: Chris.S.Handley@btinternet.com ("Chris S Handley") Date: 23 Nov 98 18:14:58 +0000 Subject: Re: Little ARexx port shutdown query Before being bought by MicroSoft, mauro fontana was able to say: > > My whole problem is the user is just using some (OO) methods to > > send/recieve arexx messages - and it ought to be perfectly valid to be > > able to send messages to yourself (unlikely I know)... > On the RKRM Libraries there is very little about Arexx, Arexx messages and > Arexx ports. I just know the essential that have allowed me to create my > Arexx utility thanks also to Marco Negri (Blacks Editor author) that has > helped me a lot. However, if you can wait till monday (I'm going home in > few minutes) I'll spot everything I can from RKRM manual and my Arexx code > to give you a description on how OS function works and should be used. Of > course as complete as I know. I can wait! ^_^ > However, if I remember right, NT_REPLY is automatically set by ReplyMsg() > function so no direct access to msg.mn.ln.type is needed. You just have to > check for it before answering not only your own messages but every one. As > you have experienced if you ignore that case, you can eneter an infinite With the module I'm using it seems to want NT_REPLYMSG not NT_REPLY; I guess you just forgot right? Strangely, using this does *not* work (maybe ReplyMsg() doesn't set NT_REPLYMSG automatically) : - --cut-- WHILE msg:=GetMsg(hostport) IF listnode.type<>NT_REPLYMSG THEN ReplyMsg(msg) ENDWHILE - --cut-- Anyone know why this don't work, when it ought to? However - from a hint from another email, the following *does* work... - --cut-- WHILE msg:=GetMsg(hostport) IF msg.replyport<>hostport THEN ReplyMsg(msg) ENDWHILE - --cut-- So, my main problem is solved now, without any nasty kludge, but I'd still like to know how you can know the number of Arguments... > loop. The idea of the reply message is to give message owning to the > sender again. You already know that sent messages cannot be modified till > they are marked as NT_REPLY by the receiver, thus signaling it has used it > and it does not need it anymore. There's no sense in sending to him the > message again as it (if written correctly) would just reply it as soon as > it receive it as it is already marked as NT_REPLY. - -- Chris S Handley, BEng(Hons) - EMAIL: Chris.S.Handley@btinternet.com an Electronic Engineer (plus an overworked PowerAmiga nut & Anime fan) - ---------------------------------------------------------------------- "One of the laws of nature," Gorden said, "is that half the people have got to be below average". "For a Gaussian distribution, yeah," Cooper said. "Sad though." [amusing except from Gregory Benford's book Timescape] @endnode @node ID34_11 "Little ARexx port shutdown query (ID34_11)" From: Chris.S.Handley@btinternet.com ("Chris S Handley") Date: 23 Nov 98 18:13:08 +0000 Subject: Re: Little ARexx port shutdown query Before being bought by MicroSoft, Maxim Olivier-Adlhoch was able to say: > Chris S Handley wrote: > > Before dying of envy of Chris's Amiga Maxim Olivier-Adlhoch was able to say: > > As I said to someone else: How to I find out the reply port? I am > > looking for an answer like "rexxmsg.mn.ln.type" perhaps with > > references to what calls produce the data object. > > the answer to your question is included in the tutorial... Thanks - this cleared-up several things which I had to guess at :-) The biggest worry I had was whether it was ok to GetMsg() without having Wait()ed first. > 2.a- You give it a reply port address... > (the Adult buys himself a house where he knows he'll always be safe). IF you have > allocated a port in the Sending Application, You SHOULD set it in the msg.replyport It seems that CreateRexxMsg() sets the .replyport automatically (not so suprising since your own port is one of it's arguments!). > field of your message... the exact syntax is probably wrong (Just so a ShowModule > on the mn OBJECT and you'll see it). Then the port will be able to tell you where > to go back when you're finished in your duty. I haven't really used ShowModule before - Doh! This was quite enlightening using it on Emodules:Exec/ports.m|nodes.m & :Rexx/storage.m . I should be able to get by on much less docs now:-) > > Maybe you can answer another question on rexx? How do I find out how > > many arguments (0 to 16) are in the the rexxmsg.args[] structure? > > Something to do with the "action field" (rexxmsg.action?) ?! > > I'm not very Skilled in AREXX specifics myself... yet I think you can't actually know - I guess that either you must check every argument (& may read if not NIL), *or* you read succesive arguments until you get a NIL. The latter sounds more likely, but I'd like someone to confirm this... BTW, with the modules I'm using, the 'don't reply' constant is called NT_REPLYMSG not NT_REPLY. - -- Chris S Handley, BEng(Hons) - EMAIL: Chris.S.Handley@btinternet.com an Electronic Engineer (plus an overworked PowerAmiga nut & Anime fan) - ---------------------------------------------------------------------- "One of the laws of nature," Gorden said, "is that half the people have got to be below average". "For a Gaussian distribution, yeah," Cooper said. "Sad though." [amusing except from Gregory Benford's book Timescape] @endnode @node ID34_12 "Little ARexx port shutdown query (ID34_12)" Date: Tue, 24 Nov 1998 17:17:34 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Little ARexx port shutdown query Chris S Handley wrote: > However - from a hint from another email, the following *does* work... > > --cut-- > WHILE msg:=GetMsg(hostport) > IF msg.replyport<>hostport THEN ReplyMsg(msg) > ENDWHILE > --cut-- /* Do not forget to Free or re-use the msg otherwise you get a nasty memory leak...> */ In the case of a standard exec msg, it depends on the way you actually allocated your msg, but you'll get the idea: WHILE msg:=GetMsg(hostport) IF msg.replyport<>hostport THEN ReplyMsg(msg) ELSE FreeVec(msg) ENDWHILE - -|\/|axim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID34_13 "Little ARexx port shutdown query (ID34_13)" Date: Wed, 25 Nov 1998 09:19:39 +0100 (MET) From: subvcbhd@calvados.zrz.TU-Berlin.DE (Henk Jonas) Subject: Re: Little ARexx port shutdown query On 23 Nov 1998, Chris S Handley wrote: > Strangely, using this does *not* work (maybe ReplyMsg() doesn't set > NT_REPLYMSG automatically) : >=20 > --cut-- > WHILE msg:=3DGetMsg(hostport) > IF listnode.type<>NT_REPLYMSG THEN ReplyMsg(msg) > ENDWHILE > --cut-- Better Not(listnode.type AND NT_REPLYMSG) ? Henk - ---------------------------------------------------------------- Henk Jonas | subvcbhd@linux.zrz.tu-berlin.de Student der | Energietechnik | http://www.cs.tu-berlin.de/~jonash > Ich lehne Atomenergie als Energiealternative ab! niX=B3 Castor < - ---------------------------------------------------------------- * AmigaMetaFileFormat * MetaView * Messlabor * Voxelflight * - ---------------------------------------------------------------- Fuer die 'Mitleser': ANARCHIEBNDAKWPKKRAFRADIKALTNTKPDPDSREVOLUT @endnode @node ID34_14 "Little ARexx port shutdown query (ID34_14)" From: Chris.S.Handley@btinternet.com ("Chris S Handley") Date: 24 Nov 98 23:25:46 +0000 Subject: Re: Little ARexx port shutdown query Before being bought by MicroSoft, mauro fontana was able to say: > This may help you somehow, but maybe you already know this: > To delete an Arexx message once it has returned from the remote hosrport > use: > DeleteArsString(msg.result2) > ClearRexxMsg(msg, 16) -> This clears all the 16 slots > DeleteRexxMsg(msg) What does ClearRexxMsg() do exactly? Must it be used? I don't use it: DeleteArgstring(rexxargs[0]) DeleteRexxMsg(rexxmsg); rexxmsg:=NIL > msg.result1 is always a value that contains a return value > msg.result2 is always a pointer to a string that may returns the anwer of > the command. > > To have valid results in those fields you have to set the RXFF_RESULT flag > in your Arexx message before you sent it to the host. Any idea what the RXCOMM flag does? This was used of instead of RXFF_RESULT, when there were no useful stuff in .result1/2 . > Hope this is going to help you. Wow! ;^) - -- Chris S Handley, BEng(Hons) - EMAIL: Chris.S.Handley@btinternet.com an Electronic Engineer (plus an overworked PowerAmiga nut & Anime fan) - ---------------------------------------------------------------------- "One of the laws of nature," Gorden said, "is that half the people have got to be below average". "For a Gaussian distribution, yeah," Cooper said. "Sad though." [amusing except from Gregory Benford's book Timescape] @endnode @node ID35_0 "Rexx Scripts (ID35_0)" From: stv@minorisa.es ("Esteve Boix") Date: Wed, 18 Nov 1998 09:22:56 +0100 Subject: Rexx Scripts Hi ! I'm writing a program that needs to execute some rexx scripts with some arguments. I use the sendRexxMsg() proc I found in a program of the "Src" dir of the AmigaE distribution. It works, but while I can run the script "rexx:script1.rexx", I cannot run "rexx:script2.rexx 60 60" -for example-. I run the scripts by sending the name of the script and it's arguments together in a string to the "REXX" port. I've tried all kind of combinations with " and ', but nothing... Anyone has an example of how to make this work ? Regards, Esteve - --- Esteve Boix - stv@minorisa.es - http://www2.minorisa.es/~stv @endnode @node ID35_1 "Rexx Scripts (ID35_1)" From: jason@fsel.com ("Jason Hulance") Subject: RE: Rexx Scripts Date: Wed, 18 Nov 1998 09:18:04 -0000 Esteve Boix wrote: > I use the sendRexxMsg() proc I found in a program of the "Src" dir of the > AmigaE distribution. That was created for Explorer to use. It was meant to be an extension to the ARexx module that Wouter wrote, but he didn't get round to integrating it, I guess. > It works, but while I can run the script "rexx:script1.rexx", I cannot > run "rexx:script2.rexx 60 60" -for example-. > I run the scripts by sending the name of the script and it's arguments > together in a string to the "REXX" port. > I've tried all kind of combinations with " and ', but nothing... > > Anyone has an example of how to make this work ? Hmm... it jolly well ought to work. I can't remember how you send arguments to scripts, but sendRexxMsg() certainly works for functions (and their arguments). It may be that, in this case, the ARexx message needs more ArgString arguments. Anyone know? Cheers! - -- Your numbers are 5, 3, 1, 8, 4 and 2. The target is 777. The conundrum for today is "aeacntctp" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID35_2 "Rexx Scripts (ID35_2)" From: stv@minorisa.es ("Esteve Boix") Date: Wed, 18 Nov 1998 18:01:44 +0100 Subject: RE: Rexx Scripts > > It works, but while I can run the script "rexx:script1.rexx", I cannot > > run "rexx:script2.rexx 60 60" -for example-. I run the scripts by > > sending the name of the script and it's arguments together in a string > > to the "REXX" port. I've tried all kind of combinations with " and ', > > but nothing... > > Hmm... it jolly well ought to work. I can't remember how you send > arguments to scripts, but sendRexxMsg() certainly works for functions (and > their arguments). It may be that, in this case, the ARexx message needs > more ArgString arguments. Anyone know? Believe it or not, the problem was the length of the path (the full path) of the rexx program... It seems to be limited to 60 chars. Can anyone verify this ? In a normal shell: 1> rx path_longer_than_60_chars.rexx ...doesn't work... ??? Regards, Esteve - --- Esteve Boix - stv@minorisa.es - http://www2.minorisa.es/~stv @endnode @node ID36_0 "MUI, Arexx And Listviews (ID36_0)" Date: Wed, 18 Nov 1998 05:03:18 -0800 (PST) From: digitaldave98@yahoo.com (David Arbuthnot) Subject: MUI, Arexx And Listviews Hi All, I am currently developing a program which uses MUI and requires 2 things before i can alpha-test it and those two things are (1). An Arexx Port (2). Some Listviews (1). Arexx Troubles I have two problems with Arexx Ports and MUI (a. Multipule Commands How Do i Do It (b. Commands with arguments Am I Right In Thinking That I Use MUIA_Application_RexxMsg Attribute. if so i need help with it (2). MUI Listviews I Have also a couple of problems with listviews I can create a list view that hold static data (Data that don`t change) but when i try to add data i have the problem that if i click on the last item to be added to the list when i click on another item it is replaced by the last item to be added. Also How DO I Use The MUIA_List_DisplayHook Attribute to format data into columns and the like If you can help i would be grateful == < Digital Dave 98 > (Or For those of you that read in Hex) $60326873717384657632686586693257563262 E + MUI = Easier GUI coding _________________________________________________________ DO YOU YAHOO!? Get your free @yahoo.com address at http://mail.yahoo.com @endnode @node ID36_1 "MUI, Arexx And Listviews (ID36_1)" From: frank@cc86.org (Frank Weber) Date: Wed, 18 Nov 1998 17:10:06 +0200 Subject: Re: MUI, Arexx And Listviews Hello David, On 18-Nov-98, you wrote: > Hi All, > > I am currently developing a program which uses MUI and requires > 2 things before i can alpha-test it and those two things are (1). An > Arexx Port (2). Some Listviews > > (2). MUI Listviews > > I Have also a couple of problems with listviews > > I can create a list view that hold static data > (Data that don`t change) but when i try to add data > i have the problem that if i click on the last item to be added > to the list when i click on another item it is replaced by the last > item to be added. Don't use static data, it always points to the same memory area. Use AllocVec for each entry instead. Example: ... OBJECT myentry data1:PTR TO CHAR data2:PTR TO CHAR ENDOBJECT DEF entry:PTR TO myentry entry:=AllocVec(SIZEOF myentry, MEMF_PUBLIC OR MEMF_CLEAR) entry.data1:=AllocVec( [required size], MEMF_PUBLIC OR MEMF_CLEAR) AstrCopy(entry.data1, 'Teststring') entry.data2:=AllocVec( [required size], MEMF_PUBLIC OR MEMF_CLEAR) AstrCopy(entry.data2, 'Teststring2') doMethodA(list, [MUIM_List_InsertSingle, entry, MUIV_List_Insert_Bottom]) And so on for every entry. > Also How DO I Use The MUIA_List_DisplayHook Attribute to format > data into columns and the like The example above has already been designed for two columns. First, set MUIA_List_Format to "," for two cols. Then set up a display hook as in the attached example. It uses NList class, but shows the way, too. Your display func would be: PROC displayfunc(hook,dest:PTR TO LONG,entry:PTR TO LONG) IF entry -> Data entry? dest[0]:=entry[0] -> Column1 dest[1]:=entry[1] -> Column2 ELSE dest[0]:='Col1' -> Show title dest[1]:='Col2' ENDIF ENDPROC Just try around a little with it. If you have any questions, just ask :-) Bye Frank - -- Frank Weber E-Mail: frank@cc86.org 74076 Heilbronn PGP key available on request Amiga Shareware: · CDCat · AFiloFaxPro · AmigaTrainer · Cheater CDCat Support site: http://www.amigaworld.com/support/cdcat aMIGA rULZ :-) @endnode @node ID37_0 "Debug messages (ID37_0)" From: misha@femina.com.pl (Michal Durys) Date: Wed, 18 Nov 1998 13:03:43 +0200 Subject: Debug messages Hi List! My idea for debug messages was to prepare a set of macros. So I did. But I wanted to know which procudre generates each message. I decided to assign a local variable called dbgprocname to each procedure which holds the it's name. I tried to put it in one macro like this: #define dbgname(name) DEF dbgprocname \ dbgprocname:=name But it seems that E desn't allow that. I tried many different ways but I didn't manage to achieve my aim. So I'd like to know if it's possible to put a variable definition and assign a string to it in one macro? At the moment I did this in a bit different way. I declared dbgprocname as a global variable and I assign a value to it in each procedure, but this solution is not perfect and I'm to lazy to do it without macros. If any one is interested here are my macros: - -> debug functions #define DEBUG #ifdef DEBUG DEF dbgprocname #define dbgname(name) dbgprocname:=name #define dbg(text,arg) PrintF('\s: '+text,dbgprocname,arg) #define qdbg(text) PrintF('\s: '+text+'\n',dbgprocname) #endif #ifndef DEBUG #define dbgname(name) #define dbg(text,args) #define qdbg(text) #endif #define DBG_DONE 'Done!' - -- Michal Durys misha@femina.com.pl Only Amiga makes it possible http://www.amiga.com @endnode @node ID37_1 "Debug messages (ID37_1)" Date: Wed, 18 Nov 1998 13:39:40 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Debug messages On Wed, 18 Nov 1998, Michal Durys wrote: =>I wanted to know which procudre generates each message. Seeing as you always have to write the message inside some procedure, why not just write the procedure's name in the message? Stuart @endnode @node ID37_2 "Debug messages (ID37_2)" From: misha@femina.com.pl (Michal Durys) Date: Thu, 19 Nov 1998 15:30:02 +0200 Subject: Re: Debug messages Hello Stuart! On 18-Lis-98 you generated such output: > =>I wanted to know which procudre generates each message. > Seeing as you always have to write the message inside some procedure, > why not just write the procedure's name in the message? I'm to lazy to add procedure name to each message. At least in source code which is about 170 KB long (no binary trash, just plain code). And I know I could define local variable dbgprocname and assign a value to it by hand but in this case I would have a lot of unused variables. Once again I know I could use a #ifdef #endif pair to exclude this part of code when DEBUG is not defined but as I said I'm too lazy for that. So, if you have any idea how to define a local variable and assign a string to it in one macro call please share it with me. Bye! - -- Michal Durys misha@femina.com.pl Only Amiga makes it possible http://www.amiga.com @endnode @node ID38_0 "MUI Listviews And MUI Arexx (ID38_0)" Date: Wed, 18 Nov 1998 08:21:09 -0800 (PST) From: digitaldave98@yahoo.com (David Arbuthnot) Subject: MUI Listviews And MUI Arexx Hi All, I Have a couple of problems that i really need help with. (1) I Got the MUI Developer files for C so i could look at the autodocs for the Attributes and Methods and decide that it was about time my programs got some arexx ports. So i tried and sucsessfully got a simple arexx command to work but then i realised what use is a command with no arguments thats what an MUI gui is for so i tried and tried and i am now going insane tring to figure ouit how to use multiple arexx comands and also arexx commands with arguments. (2) I really need some help also (Need a lot of help don`t I) with listviews i can get a listview on to my gui and use a PTR TO LONG var for its data i can also do it using E-Lists but the problems start when i add items to the list when i click on the last item added to the list and then click on another the item i just clicked on becomes the last item added to the list how do i overcome this problem. also how do i use MUIA_List_DisplayHook i know i have to use a CallBack Hook which is no problem but i cant figure out how to put my data into the columns. Hope someone can help if not i`ll stick to strings and textObjects Seeya ======================================================== = = == < Digital Dave 98 > (Or For those of you that read in Hex) $60326873717384657632686586693257563262 E + MUI = Easier GUI coding _________________________________________________________ DO YOU YAHOO!? Get your free @yahoo.com address at http://mail.yahoo.com @endnode @node ID39_0 "MUI gadget/group cycling (ID39_0)" Date: Thu, 19 Nov 1998 15:48:02 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: MUI gadget/group cycling does anyone know how to handle cycle chains in MUI? I'd also like to know how I can 'throw' a cycle 'event' in order to let MUI activate its next gadget. I'd like to add key handling to some custom gads but I must know which gadget is 'Active' otherwise I'd have to detect if I'm currently an active gadget. Oterwise I'll have to make an 'active' detection mechanism of my own. This can be a real pain to implement... it adds a lot of IFs... to an input handler... - -MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID39_1 "MUI gadget/group cycling (ID39_1)" Subject: Re: MUI gadget/group cycling From: SCHULZJAN@dame.de (Jan Hendrik Schulz) Date: Fri, 20 Nov 1998 09:00:06 +0100 Maxim Olivier-Adlhoch wrote: > does anyone know how to handle cycle chains in MUI? Set MUIA_CycleChain to 1 for every object that you want to have in your chain. > I'd also like to know how I can 'throw' a cycle 'event' in order to let > MUI activate its next gadget. set(window, MUIA_Window_ActiveObject, MUIV_Window_ActiveObject_Next) > I'd like to add key handling to some custom gads but I must know which > gadget is 'Active' otherwise I'd have to detect if I'm currently an > active gadget. get(window, MUIA_Window_ActiveObject, {activeObj}) - -- Bye...___ ______ ______ __ / /\/ / /\/ __/\ ---------------------------------------- / (/ / / / /__ /\/ Jan Hendrik Schulz - Hamburg - Germany / (_____/ /__/__/ /_____/ / schulzjan@dame.de / \____\/\__\__\/\_____\/ schulz_j@informatik.fh-hamburg.de / -------------------------------------------------------------- @endnode @node ID39_2 "MUI gadget/group cycling (ID39_2)" Date: Fri, 20 Nov 1998 17:26:15 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: MUI gadget/group cycling Hi Jan, You wrote: > Set MUIA_CycleChain to 1 for every object that you want to have in your > chain. :) that was the only part I was aware of... > > > I'd also like to know how I can 'throw' a cycle 'event' in order to let > > MUI activate its next gadget. > > set(window, MUIA_Window_ActiveObject, MUIV_Window_ActiveObject_Next) I was trying to find a tag called MUIA_xxxx_CycleNext or something like that... there are so many it becomes hard to find them sometimes ;) > > > I'd like to add key handling to some custom gads but I must know which > > gadget is 'Active' otherwise I'd have to detect if I'm currently an > > active gadget. > > get(window, MUIA_Window_ActiveObject, {activeObj}) Cool, I did not try cycling yet, as I write this, but Does MUI provide a highlighting mechanism when cyling objects or is a cursor the only visual reference? Also, do All standard gadgets Support cycling? (For example does an button have a visual clue that pressing enter would activate it, if it is supported at all? Thanks for the help. - -Maxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID40_0 "Old ideas (was: Lacking features) (ID40_0)" From: sanric@ronet.it (Riccardo Santato) Date: Fri, 20 Nov 1998 19:38:06 +0100 Subject: Old ideas (was: Lacking features) Hello Maxim Il 13-Nov-98, Maxim Olivier-Adlhoch scrisse: > > I guess it depends on his avalable time or the search for a valid person which > would handle such a task... Some time ago I suggested the idea of a new totally free AmigaE Compiler, called *"FreE"* . This idea came to me basically because in the actual state... 1) EC doesn't generate neither code for PPC nor assembly source that can be compiled with other assemblers (like PhxAss) 2) EC doesn't optimize 3) EC is totally typeless and has several problems in creating libraries 4) EC doesn't support FPU and UNSIGNED LONGs ... and many more ! :-(( I launched the idea on the Mailing List, but only 3 (!!!!) persons answered my call, and my opinion is that we cannot do a thing if we aren't in a bigger number. IMHO to join ourselves is the only way to make E survive, even because, if we do so... A) The language will become free for every Amiga user that wants to learn something about his computer ! B) More people := less errors and mistakes (everyone can hunt for bugs) C) More people := speeder implementation of the compiler ! Maybe I'm totally wrong , but it seems to me that multi-made software is the stablest software at all (check for Linux and GCC !!). If the idea is interesting, we can join. Personally I am not so able in programming (almost a newbie !) but I can create HTML pages, be a supervisor for the entire project, write docs. As John Lennon wrote... *YOU MAY SAY I'M A DREAMER BUT I'M NOT THE ONLY ONE...* /(Imagine)/ ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID40_1 "Old ideas (was: Lacking features) (ID40_1)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Sat, 21 Nov 1998 22:11:43 +0100 Subject: Re: Old ideas (was: Lacking features) Den 20-Nov-98, skrev Riccardo Santato: >Some time ago I suggested the idea of a new totally free AmigaE Compiler, >called *"FreE"* . This idea came to me basically because in the actual >state... >1) EC doesn't generate neither code for PPC nor assembly source that can be >compiled with other assemblers (like PhxAss) >2) EC doesn't optimize >3) EC is totally typeless and has several problems in creating libraries >4) EC doesn't support FPU and UNSIGNED LONGs >... and many more ! :-(( >I launched the idea on the Mailing List, but only 3 (!!!!) persons answered my >call, and my opinion is that we cannot do a thing if we aren't in a bigger >number. IMHO to join ourselves is the only way to make E survive, even >because, if we do so... >A) The language will become free for every Amiga user that wants to learn >something about his computer ! >B) More people := less errors and mistakes (everyone can hunt for bugs) >C) More people := speeder implementation of the compiler ! >Maybe I'm totally wrong , but it seems to me that multi-made software is the >stablest software at all (check for Linux and GCC !!). >If the idea is interesting, we can join. Personally I am not so able in >programming (almost a newbie !) but I can create HTML pages, be a supervisor >for the entire project, write docs. I'll be happy to help in such a project. My "features" as a programmer: I know E, pretty well. I know a little 68k asm I know enough C/C++ for simpler programms I understand pointers and such well. (And most people seem not to.) I learn quite easily. Something like that. (I didn't answer last time because I wasn't on the list) @endnode @node ID40_2 "Old ideas (was: Lacking features) (ID40_2)" From: hassel@kuai.se ("Anders Hasselqvist") Subject: Re: Old ideas (was: Lacking features) Date: Sat, 21 Nov 1998 22:33:11 +0100 Riccardo Santato wrote: > >Some time ago I suggested the idea of a new totally free AmigaE = Compiler, >called *"FreE"* . This idea came to me basically because in the actual >state... > Isn't Gregor Goldbach doing something like this already? Bye, Anders Hasselqvist hassel@acc.umu.se @endnode @node ID40_3 "Old ideas (was: Lacking features) (ID40_3)" From: frosetti@hotmail.com ("Dennis Andersson") Subject: Re: Old ideas (was: Lacking features) Date: Mon, 23 Nov 1998 03:26:29 PST >> >> I guess it depends on his avalable time or the search for a valid person >which >> would handle such a task... > >Some time ago I suggested the idea of a new totally free AmigaE Compiler, >called *"FreE"* . This idea came to me basically because in the actual >state... > >1) EC doesn't generate neither code for PPC nor assembly source that can be >compiled with other assemblers (like PhxAss) > >2) EC doesn't optimize > >3) EC is totally typeless and has several problems in creating libraries > >4) EC doesn't support FPU and UNSIGNED LONGs > >... and many more ! :-(( > >I launched the idea on the Mailing List, but only 3 (!!!!) persons answered my >call, and my opinion is that we cannot do a thing if we aren't in a bigger >number. IMHO to join ourselves is the only way to make E survive, even >because, if we do so... > >A) The language will become free for every Amiga user that wants to learn >something about his computer ! > >B) More people := less errors and mistakes (everyone can hunt for bugs) > >C) More people := speeder implementation of the compiler ! > Shouldn't that be = instead of := (or maybe == :) >Maybe I'm totally wrong , but it seems to me that multi-made software is the >stablest software at all (check for Linux and GCC !!). >If the idea is interesting, we can join. Personally I am not so able in >programming (almost a newbie !) but I can create HTML pages, be a supervisor >for the entire project, write docs. I'm willing to help in any way possible. I know some E, some html, some 68k asm, some C and some other stuff. >As John Lennon wrote... >*YOU MAY SAY I'M A DREAMER BUT I'M NOT THE ONLY ONE...* /(Imagine)/ > As Marilyn Manson wrote... *TAKE YOUR HATRED OUT ON ME...* /(Can't remeber the name of the song)/ Dennis ______________________________________________________ Get Your Private, Free Email at http://www.hotmail.com @endnode @node ID40_4 "Old ideas (was: Lacking features) (ID40_4)" Date: Mon, 23 Nov 1998 15:12:28 +0100 From: ss37@irz301.inf.tu-dresden.de (Sven Steiniger) Subject: Re: Old ideas (was: Lacking features) The best thing would be writing an frontend for gcc. This would add portability and an excellent optimizer but reduces compiling speed (compared to EC). I have no experiences in writing such front ends but it is possible (Fortran and Java frontend exists). A good start would be an lexical parser (yacc) for E. I suppose that the real trouble starts with the built-in functions (OpenW() etc.) and ends with OO-concept. And there are even more things to discuss. So whenever the FreE project starts you can add me to the list of (C/E) programmers. Ciao. - -- Sven Steiniger (ss37@inf.tu-dresden.de - http://www.inf.tu-dresden.de/~ss37) And always remember: Heaven is not a place, it's a feeling. (..."Happiness is not a state; it's a process.", Ali Graham) @endnode @node ID40_5 "Old ideas (was: Lacking features) (ID40_5)" Date: Mon, 23 Nov 1998 09:16:24 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Old ideas (was: Lacking features) Anders Hasselqvist wrote: > > Riccardo Santato wrote: > > > > >Some time ago I suggested the idea of a new totally free AmigaE Compiler, > >called *"FreE"* . This idea came to me basically because in the actual > >state... > > > > > Isn't Gregor Goldbach doing something like this already? Hello ALL, The reason I program in E is because of its syntax. because it is typeless and because it remains simple AND fast. There are many things that E programmers take for granted that C programmers would like to get. PLEASE for the sake of the Language itself, do not change the syntax. writing := instead of = is not a big issue warranting the rewrite of a language. I do admit that there are things MISSING and that Those should be addressed but Do not make the actual systems different. That is one of the reasons I shun C++. many people Think thay've got better ideas and change C/C++ syntax just a little... but then it makes two sources COMPLETELY incompatible. I'd rather code with an older tool if that meant I would not have to re-code my stuff. I've several 5000+ apploications and I'd really hate to code everything again! - -MAxim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID40_6 "Old ideas (was: Lacking features) (ID40_6)" Date: Mon, 23 Nov 1998 14:18:51 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Old ideas (was: Lacking features) On Mon, 23 Nov 1998, Sven Steiniger wrote: =>I suppose that the real trouble starts with the =>built-in functions (OpenW() etc.) and ends with =>OO-concept. A job for Java? Stuart @endnode @node ID40_7 "Old ideas (was: Lacking features) (ID40_7)" Date: Mon, 23 Nov 1998 15:47:28 +0100 (MET) From: subvcbhd@calvados.zrz.TU-Berlin.DE (Henk Jonas) Subject: Re: Old ideas (was: Lacking features) On Mon, 23 Nov 1998, Sven Steiniger wrote: > I suppose that the real trouble starts with the > built-in functions (OpenW() etc.) and ends with > OO-concept. I think you can replace the build in functions with your own. An for me, I dont use the buildin functions a lot, maybe StringF, WriteF, PrintF, sometimes, but it exist for all of them, OS functions and also C lib functions. Henk - ---------------------------------------------------------------- Henk Jonas | subvcbhd@linux.zrz.tu-berlin.de Student der | Energietechnik | http://www.cs.tu-berlin.de/~jonash > Ich lehne Atomenergie als Energiealternative ab! niX=B3 Castor < - ---------------------------------------------------------------- * AmigaMetaFileFormat * MetaView * Messlabor * Voxelflight * - ---------------------------------------------------------------- Fuer die 'Mitleser': ANARCHIEBNDAKWPKKRAFRADIKALTNTKPDPDSREVOLUT @endnode @node ID40_8 "Old ideas (was: Lacking features) (ID40_8)" Date: Mon, 23 Nov 1998 15:57:03 +0100 (MET) From: subvcbhd@calvados.zrz.TU-Berlin.DE (Henk Jonas) Subject: Re: Old ideas (was: Lacking features) On Mon, 23 Nov 1998, Maxim Olivier-Adlhoch wrote: > Anders Hasselqvist wrote: > >=20 > > Riccardo Santato wrote: > >=20 > > >Some time ago I suggested the idea of a new totally free AmigaE Compil= er, > > >called *"FreE"* . This idea came to me basically because in the actual > > >state... > >=20 > > Isn't Gregor Goldbach doing something like this already? >=20 > Hello ALL, >=20 > The reason I program in E is because of its syntax. because it is typele= ss and because > it remains simple AND fast. Yes, the typeless is IMHO a very powerfull feature, the type converting in other languages are really borring sometimes. Why cant i use in Delphi a pointer as an Integer and my Integer as a pointer (ok this direction worked, but the other doesn't) Henk - ---------------------------------------------------------------- Henk Jonas | subvcbhd@linux.zrz.tu-berlin.de Student der | Energietechnik | http://www.cs.tu-berlin.de/~jonash > Ich lehne Atomenergie als Energiealternative ab! niX=B3 Castor < - ---------------------------------------------------------------- * AmigaMetaFileFormat * MetaView * Messlabor * Voxelflight * - ---------------------------------------------------------------- Fuer die 'Mitleser': ANARCHIEBNDAKWPKKRAFRADIKALTNTKPDPDSREVOLUT @endnode @node ID40_9 "Old ideas (was: Lacking features) (ID40_9)" Date: Mon, 23 Nov 1998 16:29:19 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Old ideas (was: Lacking features) > > I suppose that the real trouble starts with the > > built-in functions (OpenW() etc.) and ends with > > OO-concept. > I think you can replace the build in functions with your own. An for me, I > dont use the buildin functions a lot, maybe StringF, WriteF, PrintF, > sometimes, but it exist for all of them, OS functions and also C lib > functions. Oh, well, I think E custom functions can be rewritten as the original ones in C. The question is how much work will it take to port all those useful functions that works with strings and lists, input and output, and gfx stuff. However, how are you going to make gcc compile the eventual Assembly parts of the code? Aren't you certanly going to remove E assembly support (and perfect integration) from it, are you? And no, external module compilation and linkink is not good as in E I can use normal E variables as parameters. Moreover I think lots of other E specific features cannot be handled correclty (exception handling/list cells/resource traking and garbage collector). I think the only option is to rewrite the source code completely (even in E) and adding new features as native instead of making E a bunch of hacks and macros suited only for gcc maniacs (people in year 2000 cannot still program with gcc and its absurd command line syntax, can they?). However this work should be profitable (less time/better code/high efficiency) only if Wouter himself is going to work on it as well. M&F @endnode @node ID40_10 "Old ideas (was: Lacking features) (ID40_10)" Date: Mon, 23 Nov 1998 16:52:25 +0100 (MET) From: subvcbhd@calvados.zrz.TU-Berlin.DE (Henk Jonas) Subject: Re: Old ideas (was: Lacking features) On Mon, 23 Nov 1998, mauro fontana wrote: > Oh, well, I think E custom functions can be rewritten as the original one= s > in C. The question is how much work will it take to port all those useful > functions that works with strings and lists, input and output, and gfx > stuff. Not so much work as the automatic translation from E to C, i think. > perfect integration) from it, are you? And no, external module compilatio= n > and linkink is not good as in E I can use normal E variables as > parameters.=20 I dont know anything about Linkers, but maybe in the Obj. file you can connect the local variables in the C and the ASM part, but i think the only reason for E -> C is the porting ability, so you cant use ASM in this case. =20 > Moreover I think lots of other E specific features cannot be handled > correclty (exception handling/list cells/resource traking and garbage > collector). The limit garbage collection in E can be replaced with some extra code, that noted all memory allocations and freed they in the exit part. > I think the only option is to rewrite the source code completely (even in > E) and adding new features as native instead of making E a bunch of hacks > and macros suited only for gcc maniacs (people in year 2000 cannot still Thats the best, of cause, but a simple E to C translation would make me happy. I like to start to program in E, but later i want to use the powerfull features of C as well. I have xxx kByte code to translate in the next time, because i want to write MetaView and AMF.library in C. That's my horror :-) The stupid change of brackets, cases etc. > program with gcc and its absurd command line syntax, can they?). However The ec command line syntax is far from making sense and not style guide=20 :-) Henk - ---------------------------------------------------------------- Henk Jonas | subvcbhd@linux.zrz.tu-berlin.de Student der | Energietechnik | http://www.cs.tu-berlin.de/~jonash > Ich lehne Atomenergie als Energiealternative ab! niX=B3 Castor < - ---------------------------------------------------------------- * AmigaMetaFileFormat * MetaView * Messlabor * Voxelflight * - ---------------------------------------------------------------- Fuer die 'Mitleser': ANARCHIEBNDAKWPKKRAFRADIKALTNTKPDPDSREVOLUT @endnode @node ID40_11 "Old ideas (was: Lacking features) (ID40_11)" Date: Mon, 23 Nov 1998 17:38:52 +0100 From: ss37@irz301.inf.tu-dresden.de (Sven Steiniger) Subject: Re: Old ideas (was: Lacking features) Henk Jonas wrote: > > On Mon, 23 Nov 1998, mauro fontana wrote: > > > Oh, well, I think E custom functions can be rewritten as the original ones > > in C. The question is how much work will it take to port all those useful > > functions that works with strings and lists, input and output, and gfx > > stuff. > Not so much work as the automatic translation from E to C, i think. Eeeeekkkk! Writing an frontend for gcc has nothing to do with writing an EtoC translator. I suppose you remember those ugly C++ frontends that generates giant C sources? The concept of gcc is to use an frontend which parses the source and generates something like an abstract syntax-tree, now the optimizer starts and optimizes this tree and passes this to the backend which makes an assembler program from it. So writing the frontend has not much to do with C except that you must write it in C. The problem is: it is not trival. Eq. How to put OO-concept into the syntax-tree. > > perfect integration) from it, are you? And no, external module compilation > > and linkink is not good as in E I can use normal E variables as > > parameters. Asm-stubs can also use normal variables (even expressions), eq: asm("addl %2, %0" : "=r" (result) : "0" (summand1), "dim" (func(arg1, arg2))) Which just does result:=summand1+func(arg1, arg2) and handles all register allocations itself. Again the problem is to parse e-inline asm and put it into the syntax-tree. The sources are also not portable. > I dont know anything about Linkers, but maybe in the Obj. file you can > connect the local variables in the C and the ASM part, but i think the > only reason for E -> C is the porting ability, so you cant use ASM in this > case. > > > Moreover I think lots of other E specific features cannot be handled > > correclty (exception handling/list cells/resource traking and garbage > > collector). > The limit garbage collection in E can be replaced with some extra code, > that noted all memory allocations and freed they in the exit part. I think only lisp cells are an problem (but how uses it?). > > I think the only option is to rewrite the source code completely (even in > > E) and adding new features as native instead of making E a bunch of hacks > > and macros suited only for gcc maniacs (people in year 2000 cannot still Do you really wanna write an complete compiler in E? - -- Sven Steiniger (ss37@inf.tu-dresden.de - http://www.inf.tu-dresden.de/~ss37) And always remember: Heaven is not a place, it's a feeling. (..."Happiness is not a state; it's a process.", Ali Graham) @endnode @node ID40_12 "Old ideas (was: Lacking features) (ID40_12)" Date: Mon, 23 Nov 1998 18:00:13 +0100 (MET) From: subvcbhd@calvados.zrz.TU-Berlin.DE (Henk Jonas) Subject: Re: Old ideas (was: Lacking features) On Mon, 23 Nov 1998, Sven Steiniger wrote: > Henk Jonas wrote: > > Not so much work as the automatic translation from E to C, i think. >=20 > Eeeeekkkk! Writing an frontend for gcc has nothing to do with writing > an EtoC translator. I suppose you remember those ugly C++ frontends > that generates giant C sources? The concept of gcc is to use an > frontend which parses the source and generates something like an > abstract syntax-tree, now the optimizer starts and optimizes this > tree and passes this to the backend which makes an assembler > program from it. So writing the frontend has not much to do > with C except that you must write it in C. > The problem is: it is not trival. Eq. How to put OO-concept into > the syntax-tree. Aha, (expression of surprising) nice to hear about it. If someone write such a frontend we get a portable E Compiler? I think this would be very usefull. So, come on and go for it :-) > I think only lisp cells are an problem (but how uses it?). How or Who? Answare: I dont know. > Do you really wanna write an complete compiler in E? Then we have another not portable compiler that produce unportable code... Henk - ---------------------------------------------------------------- Henk Jonas | subvcbhd@linux.zrz.tu-berlin.de Student der | Energietechnik | http://www.cs.tu-berlin.de/~jonash > Ich lehne Atomenergie als Energiealternative ab! niX=B3 Castor < - ---------------------------------------------------------------- * AmigaMetaFileFormat * MetaView * Messlabor * Voxelflight * - ---------------------------------------------------------------- Fuer die 'Mitleser': ANARCHIEBNDAKWPKKRAFRADIKALTNTKPDPDSREVOLUT @endnode @node ID40_13 "Old ideas (was: Lacking features) (ID40_13)" Date: Mon, 23 Nov 1998 18:14:58 +0100 From: ss37@irz301.inf.tu-dresden.de (Sven Steiniger) Subject: Re: Old ideas (was: Lacking features) > > Eeeeekkkk! Writing an frontend for gcc has nothing to do with writing > > an EtoC translator. I suppose you remember those ugly C++ frontends > > that generates giant C sources? The concept of gcc is to use an > > frontend which parses the source and generates something like an > > abstract syntax-tree, now the optimizer starts and optimizes this > > tree and passes this to the backend which makes an assembler > > program from it. So writing the frontend has not much to do > > with C except that you must write it in C. > > The problem is: it is not trival. Eq. How to put OO-concept into > > the syntax-tree. > Aha, (expression of surprising) > nice to hear about it. If someone write such a frontend we get a portable > E Compiler? I think this would be very usefull. > So, come on and go for it :-) Good luck when diving into the depths of gcc! > > I think only lisp cells are an problem (but how uses it?). > How or Who? :) I meant "who". "How" is not the problem but for what? Unification is very powerful but is it useful in normal E-programs? > > Do you really wanna write an complete compiler in E? > Then we have another not portable compiler that produce unportable code... Just make it an cross-compiler ;) - -- Sven Steiniger (ss37@inf.tu-dresden.de - http://www.inf.tu-dresden.de/~ss37) And always remember: Heaven is not a place, it's a feeling. (..."Happiness is not a state; it's a process.", Ali Graham) @endnode @node ID40_14 "Old ideas (was: Lacking features) (ID40_14)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Mon, 23 Nov 1998 22:18:24 +0100 Subject: Re: Old ideas (was: Lacking features) Den 23-Nov-98, skrev mauro fontana: >I think the only option is to rewrite the source code completely (even in >E) and adding new features as native instead of making E a bunch of hacks >and macros suited only for gcc maniacs (people in year 2000 cannot still >program with gcc and its absurd command line syntax, can they?). However >this work should be profitable (less time/better code/high efficiency) >only if Wouter himself is going to work on it as well. Is Wouter still "alive" at all? FreE should be able to compile itself. A tree-thingy for GCC is fine, hopefully one can be written and compiled with the current EC, and then we can recompile FreE with "the real thing" once it's working.. and the tree-thing can be compiled for another platform I would think, so portability wouldn't be a problem. (Yes, I think it's a point that it's written in E) @endnode @node ID40_15 "Old ideas (was: Lacking features) (ID40_15)" Date: Tue, 24 Nov 1998 13:39:17 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Old ideas (was: Lacking features) > > Do you really wanna write an complete compiler in E? > Then we have another not portable compiler that produce unportable code... If you want portable code learn C/C++. That exists on almost all available computer on the Earth. However, I my "complains" on E are not for portability (I would never try to port a quite complex program with a user interface or anything Amiga specific to a PC or Mac), but just because it has not evolved enough to reach the power of C++ by keeping its simple syntax and advantages. I would not like to see my E code transformed in C code, as well as would not like to wait 5 minutes for a compile instead of the 5 seconds that needs EC, which has a command template like all other Amiga programs (unlike gcc). M&F @endnode @node ID40_16 "Old ideas (was: Lacking features) (ID40_16)" Date: Tue, 24 Nov 1998 13:43:55 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Old ideas (was: Lacking features) > > > perfect integration) from it, are you? And no, external module compilation > > > and linkink is not good as in E I can use normal E variables as > > > parameters. > > Asm-stubs can also use normal variables (even expressions), eq: > asm("addl %2, %0" : "=r" (result) : "0" (summand1), "dim" (func(arg1, > arg2))) > Which just does result:=summand1+func(arg1, arg2) and handles all > register allocations itself. > Again the problem is to parse e-inline asm and put it into the > syntax-tree. The sources are also not portable. Erm.... what was that? Would that be the way to use ASM with external references? Give me a PPC assembler manual, please, that seems much easier! > > > I think the only option is to rewrite the source code completely (even in > > > E) and adding new features as native instead of making E a bunch of hacks > > > and macros suited only for gcc maniacs (people in year 2000 cannot still > > Do you really wanna write an complete compiler in E? What is the problem with that? Just that you can port the compiler on the PC? M&F @endnode @node ID40_17 "Old ideas (was: Lacking features) (ID40_17)" Date: Tue, 24 Nov 1998 13:54:48 +0100 From: raptor@cs.tu-berlin.de (Gul Dukat) Subject: Re: Old ideas (was: Lacking features) > If you want portable code learn C/C++. That exists on almost all available > computer on the Earth. However, I my "complains" on E are not for To write portable code it is not needed to learn C/C++. C/C++ is a language which generates an extrem high overhead when compiling and this is not needed. It is something like a very huge preprocessor 8-) Also a lot of the code isn't really portable (look at macros like #ifdef MAXSEG_64K etc.). Writing a compiler which uses a portable language means the creation of a basical environment like in Java VMs. I don't like C/C++ because the portability-feature should be done by the codegenerator and not by the author. Therefore a strategy is needed to manage function-calls, structures, shared-libraries etc. which allows to be ported on several systems (on the level of the codegenerator). If amigaspecific stuff will be thrown out of the E compiler the language can reach this goal. My oppinion 8-) @endnode @node ID40_18 "Old ideas (was: Lacking features) (ID40_18)" From: zokie@teseo.it (Francesco De Napoli) Date: Tue, 24 Nov 1998 20:27:22 +0100 Subject: Re: Old ideas (was: Lacking features) Hello mauro On 24-Nov-98, mauro fontana wrote: > Erm.... what was that? Would that be the way to use ASM with external > references? Give me a PPC assembler manual, please, that seems much > easier! This is easy and free :) Go to http://www.mot-sps.com/sps/General/sales.html and order all Motorola's book for free. This summer I got all 68K and many PPC books. After 4 or 5 days they are at your home. Regards - -- "When do you want to reboot today?" @endnode @node ID40_19 "Old ideas (was: Lacking features) (ID40_19)" Date: Wed, 25 Nov 1998 18:45:37 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Old ideas (was: Lacking features) On Tue, 24 Nov 1998, Francesco De Napoli wrote: =>and order all Motorola's book for free. This summer I got all 68K and many =>PPC books. After 4 or 5 days they are at your home. Remember to be at home when they deliver them or you'll have to walk down to your postal depot to pick it up, and it's not lightweight! Stuart @endnode @node ID41_0 "Subjects (ID41_0)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Sat, 21 Nov 1998 22:11:54 +0100 Subject: Subjects I think this list should have a list-identifier added to the subjects of the emails, like many other lists. It would make it easier to tell E mails from private mails. (Something like this mail getting the subject "[E] Subjects" automatically) @endnode @node ID41_1 "Subjects (ID41_1)" From: agraham@hal9000.net.au (Ali Graham) Date: Mon, 23 Nov 1998 01:10:13 +0930 Subject: Re: Subjects On 22-Nov-98, someone (I think it was Carl Drougge) might have written: CD> I think this list should have a list-identifier added to the subjects of CD> the emails, like many other lists. It would make it easier to tell E CD> mails from private mails. CD> CD> (Something like this mail getting the subject "[E] Subjects" CD> automatically) Why not just filter the messages into a separate folder based on mail headers? - -- Ali Graham [ mailto:agraham@hal9000.net.au ] [ http://hal9000.net.au/~agraham/ ] "I'm Doctor Bunsen Honeydew here at Microsoft Labs, where the future is being made today! Beaker - put down those Dilithium Crystals and wave to the nice viewers!" @endnode @node ID41_2 "Subjects (ID41_2)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Sun, 22 Nov 1998 22:13:11 +0100 Subject: Re: Subjects Den 22-Nov-98, skrev Ali Graham: >On 22-Nov-98, someone (I think it was Carl Drougge) might have written: >CD> I think this list should have a list-identifier added to the subjects of >CD> the emails, like many other lists. It would make it easier to tell E >CD> mails from private mails. >CD> >CD> (Something like this mail getting the subject "[E] Subjects" >CD> automatically) >Why not just filter the messages into a separate folder based >on mail headers? Because I don't feel like it. =) I'd just forget to ever look in that folder.. @endnode @node ID41_3 "Subjects (ID41_3)" From: eq3nmf@eq.uc.pt (Nuno Maltez) Date: Sun, 22 Nov 1998 11:33:43 +0100 Subject: Re: Subjects Hi Carl, > I think this list should have a list-identifier added to the subjects of > the emails, like many other lists. It would make it easier to tell E mails > from private mails. > > (Something like this mail getting the subject "[E] Subjects" automatically) I don't think so, unless it's optional and each user can choose if he wants to receive the e-mail with or without the identifier. I alredy filter my mails into seprate folders and it serves no puropse to have an entire folder of e-mails all starting with [E] :-) Regards - -- Nuno @endnode @node ID41_4 "Subjects (ID41_4)" From: tommy@pitea.mail.telia.com (Tommy Lindgren) Date: Wed, 25 Nov 1998 18:44:52 +0200 Subject: Re: Subjects Hello Carl On 22-Nov-98, you wrote: > Den 22-Nov-98, skrev Ali Graham: >> On 22-Nov-98, someone (I think it was Carl Drougge) might have written= : >> CD> I think this list should have a list-identifier added to the subj= ects of >> CD> the emails, like many other lists. It would make it easier to tel= l E >> CD> mails from private mails. >> CD> = >> CD> (Something like this mail getting the subject "[E] Subjects" >> CD> automatically) >> Why not just filter the messages into a separate folder based >> on mail headers? > Because I don't feel like it. =3D) > I'd just forget to ever look in that folder.. I see that you use YAM 1.3.5. Why not upgrade to = YAM 2.00p6? Get it from http://www.yam.ch ! - -- = Tommy Lindgren - tomyl@telia.com http://w1.911.telia.com/~u91103938 = ICQ UIN: 13659426 = "Shit Happens" according to... Einsteinism: Shit is Relative. @endnode @node ID41_5 "Subjects (ID41_5)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Thu, 26 Nov 1998 01:03:06 +0100 Subject: Re: Subjects Den 25-Nov-98, skrev Tommy Lindgren: >I see that you use YAM 1.3.5. Why not upgrade to >YAM 2.00p6? Get it from http://www.yam.ch ! Because this version works, betas tend not to. =) @endnode @node ID41_6 "Subjects (ID41_6)" From: tommy@pitea.mail.telia.com (Tommy Lindgren) Date: Fri, 27 Nov 1998 18:28:26 +0200 Subject: Re: Subjects Hello Carl On 26-Nov-98, you wrote: > Den 25-Nov-98, skrev Tommy Lindgren: >> I see that you use YAM 1.3.5. Why not upgrade to >> YAM 2.00p6? Get it from http://www.yam.ch ! > Because this version works, betas tend not to. =) OK.. but it /looks/ nice :-) Actually, so far /I/ haven't had any problems with p6... I really like it! - -- Tommy Lindgren - tomyl@telia.com http://w1.911.telia.com/~u91103938 ICQ UIN: 13659426 Murphy's Law No. 41: A bird in hand is safer than one overhead. @endnode @node ID41_7 "Subjects (ID41_7)" From: sanric@ronet.it (Riccardo Santato) Date: Fri, 27 Nov 1998 18:20:39 +0100 Subject: Re: Subjects Hello Carl Il 21-Nov-98, Carl Drougge scrisse: > I think this list should have a list-identifier added to the subjects of the > emails, like many other lists. It would make it easier to tell E mails from > private mails. > > (Something like this mail getting the subject "[E] Subjects" automatically) > Yeah, it would be great !! I'm personally personally involved in 3 mailing list and it's becoming confused... ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID41_8 "Subjects (ID41_8)" Date: Mon, 30 Nov 1998 10:00:56 +0100 From: Rainer.M.Mueller@uni-konstanz.de (Rainer =?iso-8859-1?Q?M=FCller?=) Subject: Re: Subjects Hi ! >> I think this list should have a list-identifier added to the subjects of the >> emails, like many other lists. It would make it easier to tell E mails= from >> private mails. >>=20 >> (Something like this mail getting the subject "[E] Subjects"= automatically) >>=20 > >Yeah, it would be great !! I'm personally personally involved in 3 mailing >list and it's becoming confused...=20 You don't need a "[E] Subject" for that. I use Eudora Light and I filter the mails of this mailing-list using the reply-to field.=20 - -> IF reply-to =3D amigae-list THEN= place_this_mail_in_the_e-mailinglist_mailbox this works perfect without any problems !! Greetings, Rainer =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D // Rainer M=FCller A1200-030-50MHz 16MB/850MB // Pentium 166MHz 32MB/2.1GB // have a look at: Aminet:mus/edit/SampleE \\ // \X/ AMIGA for ever ! @endnode @node ID41_9 "Subjects (ID41_9)" Date: Mon, 30 Nov 1998 01:09:02 -0800 From: dobes@mindless.com (Dobes Vandermeer) Subject: Re: Subjects Rainer Müller wrote: > > Hi ! > > >> I think this list should have a list-identifier added to the subjects of > the > >> emails, like many other lists. It would make it easier to tell E mails from > >> private mails. > >> > >> (Something like this mail getting the subject "[E] Subjects" automatically) > >> > > > >Yeah, it would be great !! I'm personally personally involved in 3 mailing > >list and it's becoming confused... > > You don't need a "[E] Subject" for that. I use Eudora Light and I filter > the mails of this mailing-list using the reply-to field. > -> IF reply-to = amigae-list THEN place_this_mail_in_the_e-mailinglist_mailbox You need the [E] so you can filter visually if you do not like to divide your mail into folders all the time. Everywhere i hear this damn stupid argument, neither side underatsing the other.... W dont WNAT to FILTER, we jstu want to SEE automatically which messages are for the E list. That way we can scan (using our eyes) down a long list of messages and see which are personal messages and which are from mailing lists. I hope you understand now. CU Dobes @endnode @node ID42_0 "AmigaCentral.com - Is Now Open - http://www.amigacentral.com (ID42_0)" From: cb.price@ukonline.co.uk (Phil Price) Date: Wed, 02 Sep 1992 12:59:58 +0000 Subject: AmigaCentral.com - Is Now Open - http://www.amigacentral.com Hello, My Name is Phil Price And i'm the Webmaster Of AmigaCentral.com The Online Amiga Magazine. And i's liek to inform you that after much hasstle and problems it's finally open ! Please have a look at http://www.amigacentral.com . I think you'll find it a good read and questions to info@amigacentral.com, or reply to me directly. As Always we are looking for Your Mods, Graphics and Utils. Please send them to contrib@amigacentral.com, we hope to here form you soon. Thank You. Phil Price , Webmaster/Editor Of AmigaCentral Phil@amigacentral.com @endnode @node ID43_0 "gui problem (ID43_0)" From: garymag@hotmail.com ("Gary Maguire") Subject: gui problem Date: Sun, 22 Nov 1998 06:56:50 PST Hello Chaps. Is it possible to include an object internal call in an easygui or newgui button definition? Here is my problem: OPT MODULE OBJECT gui various defs ENDOBJECT PROC creategui() OF gui [BUTTON,{proc}, etc etc ENDPROC Where proc is a module call such as self.doSomething() Thanks for any comments, sorry if I'm being silly TTFN ______________________________________________________ Get Your Private, Free Email at http://www.hotmail.com @endnode @node ID44_0 "Bitmap blitting and backfill hooks (ID44_0)" From: chris@planb.thegap.com (Christopher Perver) Date: Sun, 22 Nov 1998 21:50:20 +0000 Subject: Bitmap blitting and backfill hooks Hello all, I have managed to load an IFF file as a bitmap, and want to fill a window with it. The problem I am having is that the bitmap is smaller than the window, and I don't know how to make the bitmap tile. BltBitmapRastport() expects the src to be the same size as the dest. Can anyone help me with this? The thing I am trying to do is to do with window backfill hooks. This is where I have a second problem. The hook PROC for the backfill has several parameters... I have looked up my RKRM Includes manual and this is what I have got, but I think it is probably wrong, as it doesn't seem to work, as I think some of the parameters might be wrong. I am not sure the message parameter is actually an array. But the RKRM manual did have this... message == [ (Layer *) layer, (struct Rectangle) bounds, (WORD) offsetx, (WORD) offsety ] PROC backFillHook(hook:PTR TO hook, rp:PTR TO rastport, mes:PTR TO LONG) DEF lay:PTR TO layer, bounds:PTR TO rectangle, x, y lay := mes[0] bounds := mes[1] x := mes[2] y := mes[3] BltBitMapRastPort(bmp, 0, 0, rp, bounds.minx + x, bounds.miny + y, bounds.maxx, bounds.maxy, $C0) ENDPROC I hope someone can help. Thanks - -- Regards, Chris. And it shall come to pass, that whosoever shall call on the name of the Lord shall be saved. Acts 2:21 http://www.jvim.com/ @endnode @node ID44_1 "Bitmap blitting and backfill hooks (ID44_1)" Date: Mon, 23 Nov 1998 12:52:04 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Bitmap blitting and backfill hooks > I am not sure the message parameter is actually an array. > But the RKRM manual did have this... > > message == [ (Layer *) layer, (struct Rectangle) bounds, > (WORD) offsetx, (WORD) offsety ] > > > PROC backFillHook(hook:PTR TO hook, rp:PTR TO rastport, mes:PTR TO LONG) > DEF lay:PTR TO layer, bounds:PTR TO rectangle, x, y ^^^^^^^^^^^^^^^^^^^^^^^ > > lay := mes[0] > bounds := mes[1] > x := mes[2] > y := mes[3] > > BltBitMapRastPort(bmp, 0, 0, > rp, bounds.minx + x, bounds.miny + y, > bounds.maxx, bounds.maxy, $C0) > I can't remeber the right parameters for the Layer cals, but: look at there: if the C declaration is right bounds is not a pointer but a complete rectangle structure. Moreover if msg is defined as a PTR TO LONG the two WORDS x and Y will not be in the right position. You have to change the msg PTR or have to "manually" merge the two words in a single LONG (not that difficult both in Assemby or using normal E commands). Hope this will help you. M&F @endnode @node ID44_2 "Bitmap blitting and backfill hooks (ID44_2)" From: jason@fsel.com ("Jason Hulance") Subject: RE: Bitmap blitting and backfill hooks Date: Mon, 23 Nov 1998 13:25:28 -0000 Christopher Perver wrote: > The hook PROC for the backfill has several parameters... > I have looked up my RKRM Includes manual and this is what I > have got, but I think it is probably wrong, as it doesn't seem > to work, as I think some of the parameters might be wrong. > > I am not sure the message parameter is actually an array. > But the RKRM manual did have this... > > message == [ (Layer *) layer, (struct Rectangle) bounds, > (WORD) offsetx, (WORD) offsety ] This translates to: OBJECT backfilldata layer:PTR TO layer bounds:rectangle offsetx:INT offsety:INT ENDOBJECT > PROC backFillHook(hook:PTR TO hook, rp:PTR TO rastport, mes:PTR TO LONG) > DEF lay:PTR TO layer, bounds:PTR TO rectangle, x, y > lay := mes[0] > bounds := mes[1] > x := mes[2] > y := mes[3] > BltBitMapRastPort(bmp, 0, 0, > rp, bounds.minx + x, bounds.miny + y, > bounds.maxx, bounds.maxy, $C0) > ENDPROC So, this would be: PROC backFillHook(hook:PTR TO hook, rp:PTR TO rastport, mes:PTR TO backfilldata) BltBitMapRastPort(bmp, 0, 0, rp, mes.bounds.minx + mes.offsetx, mes.bounds.miny + mes.offsety, mes.bounds.maxx, mes.bounds.maxy, $C0) ENDPROC Ali Graham was doing something with backfill hooks in his library version of EasyGUI. You might like to ask him how he got on. Cheers! - -- Your numbers are 75, 1, 3, 2, 8 and 2. The target is 398. The conundrum for today is "naloelgag" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID45_0 "E Objects (ID45_0)" Date: Mon, 23 Nov 1998 16:17:13 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: E Objects Hulance's reply to the previous backfill problem raised some questions in my mind which are not necessary linked to the previous problem (well, they are not at all). Hulance has transormed an array into an object which is surely a better solution than messing with pointers as I have adviced in my previous answer. However I still can understand how E objects are hanled internally as lots of times I have seen they just break my code... Here an example... I had enough of the exec list handling functions that have to be applied to objects. So I thought to make a link module that would have intergrated all the Exec's list function as methods for my lkn/mlkn (same as ln/mln) and mlkh/lkh (same as lh/mlh. Those objects are defined as: OBJECT mlkn OF mln ENDOBJECT OBJECT lnk OF mln pri:CHAR type:CHAR -> Hope this are right typed name:LONG ENDOBJECT Lists are copy of the exec list as above for nodes. mlkn has a method defined: remove lkn inherits the same method. mlkh has initlist, addtail and addhead methods mlh inherits the same methods. Those methods are just calls to the Exec functions witht the right parmeters (i.e. AddTail(self, node) etc..) It took me two hours to understand that, to make my objects, that inherited the methods, work with the system exec routines I have to define them as OF mln/mlh and not create them ex-novo with the same fields such as: OBJECT mlkn succ:PTR TO mlkn pred:PTR TO mlkn ENDOBJECT OBJECT mlkh head:LONG tail:LONG tailpred:LONG ENDOBJECT Etc.. the same as above. This last ones seems to have a private long as their first field that make Exc function not working th right way. Once I found the right way to define the objects and make them work the right way with the Exec routines, I then wanted to eliminate those calls to the amigalib.m module for list initialising. But there's no way to write the init function in E, and I did not tried in assembly (following the example on the RKM) as I already know the offsets of the fields are not right. So, I could not make my own link module without references to the exec/lists.m, exec/nodes.m and amigalib.m modules. Can anyone explain me how I can obtain objects with methods that have not changed offsets with respect to the AmigaOS C includes? Thanks. M&F @endnode @node ID45_1 "E Objects (ID45_1)" From: carl.drougge@2.sbbs.se (Carl Drougge) Date: Mon, 23 Nov 1998 22:29:29 +0100 Subject: Re: E Objects Den 23-Nov-98, skrev mauro fontana: >Can anyone explain me how I can obtain objects with methods that have not >changed offsets with respect to the AmigaOS C includes? I think E allways needs the first long to be a pointer to a function table. But I don't really see the problem.. OBJECT whatnot ln : ln whatever ENDOBJECT PROC remove() OF whatnot IS Remove( self.ln ) And so on.. > So, I could not make my own link module without references to the > exec/lists.m, exec/nodes.m and amigalib.m modules. All the stuff can of course be rewritten in E.. Say newList() for example: PROC newList( lh : PTR TO lh ) lh.tailpred := lh lh.tail := NIL lh.head := lh + 4 ENDPROC But of course the same principle with PROC init() OF whatever IS newList( self.lh ) works just fine here too. @endnode @node ID45_2 "E Objects (ID45_2)" From: jason@fsel.com ("Jason Hulance") Subject: RE: E Objects Date: Tue, 24 Nov 1998 08:55:10 -0000 mauro fontana wrote: > Hulance has transormed an array into an object which is surely a better > solution than messing with pointers as I have adviced in my previous > answer. I think the C includes are missing a data structure for the backfill hook data, as there's one for some other hooks. The first thing a C coder would do on meeting that RKRM description is write a struct to describe the data. It's no different in E: writing an OBJECT is the best thing to do. It's just a shame there isn't one written for you already in the system includes... > However I still can understand how E objects are hanled internally > as lots of times I have seen they just break my code... Yes, if you have the wrong idea about how objects work and you make bad assumptions then your code is likely to break. > Here an example... > > I had enough of the exec list handling functions that have to be applied > to objects. So I thought to make a link module that would have intergrated > all the Exec's list function as methods for my lkn/mlkn (same as ln/mln) > and mlkh/lkh (same as lh/mlh. Those objects are defined as: > > OBJECT mlkn OF mln > ENDOBJECT > > OBJECT lnk OF mln > pri:CHAR > type:CHAR -> Hope this are right typed > name:LONG > ENDOBJECT > > Lists are copy of the exec list as above for nodes. > > mlkn has a method defined: remove > lkn inherits the same method. So lnk is actually "OF mlkn" not "OF mln"? > mlkh has initlist, addtail and addhead methods > mlh inherits the same methods. "mlh" is the system object. So, I guess you mean your own "lnkh" or something. > Those methods are just calls to the Exec functions witht the right > parmeters (i.e. AddTail(self, node) etc..) Sounds fine. > It took me two hours to understand that, to make my objects, that > inherited the methods, work with the system exec routines I have to define > them as OF mln/mlh and not create them ex-novo with the same fields such > as: Well, look in the E.guide. At the end of Ch14D, Wouter explains that you can add methods to system objects, and this keeps compatibility with those objects. Wouter does skimp a bit on documentation, but the obvious implication is that writing an OBJECT with the same elements (not using "OF") will *not* be compatible. In fact, nowhere else does the E.guide suggest any correspondence of an OOP OBJECT with a simple OBJECT. So you shouldn't have assumed any. > This last ones seems to have a private long as their first field that make > Exc function not working th right way. Yes. But you want to avoid using this knowledge. If Wouter changes the way OOP OBJECTs work then your code may break. You can only assume what Wouter tells you (in the E.guide). > Once I found the right way to define the objects and make them work the > right way with the Exec routines, I then wanted to eliminate those calls > to the amigalib.m module for list initialising. > > But there's no way to write the init function in E, and I did not tried in > assembly (following the example on the RKM) as I already know the offsets > of the fields are not right. This is tricky, since the normal Exec lists treat the list header like two nodes, overlaid in the same memory. So, no, you wouldn't think it was possible to mimic this directly using OOP OBJECTs. But you can, if you're careful, since you should be wrapping the classes so that you *never* treat the "node" parts of the list header as OOP nodes ("mlkn" in your example). Remember: you (should) *never* need to. To be completely explicit: because of the system object compatibility that Wouter has implemented, you only need to avoid calling methods on such a node. So you can borrow the code from Src/Tools/AmigaLib/lists.e, and be careful in the other methods. You're making the data PRIVATE, aren't you? > Can anyone explain me how I can obtain objects with methods that have not > changed offsets with respect to the AmigaOS C includes? Wouter documents this in Ch14D of E.guide, as I said above. Cheers! - -- Your numbers are 50, 2, 7, 2, 4 and 3. The target is 282. The conundrum for today is "tniieutst" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID45_3 "E Objects (ID45_3)" Date: Tue, 24 Nov 1998 13:28:48 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: RE: E Objects > Well, look in the E.guide. At the end of Ch14D, Wouter explains that you > can add methods to system objects, and this keeps compatibility with > those objects. Wouter does skimp a bit on documentation, but the obvious > implication is that writing an OBJECT with the same elements (not using > "OF") will *not* be compatible. In fact, nowhere else does the E.guide > suggest any correspondence of an OOP OBJECT with a simple OBJECT. So you > shouldn't have assumed any. Well, he even does not say they are different 8)... so I presumed no changes where done to objects with methods. > This is tricky, since the normal Exec lists treat the list header like two > nodes, overlaid in the same memory. So, no, you wouldn't think it was > possible to mimic this directly using OOP OBJECTs. But you can, if you're > careful, since you should be wrapping the classes so that you *never* > treat the "node" parts of the list header as OOP nodes ("mlkn" in your > example). Remember: you (should) *never* need to. You got the point. I wanted the OOP link class to be able to access successive/preeceding nodes and, of course, at least use their methods. But it seems this is not possible to do this and keeping compatibility with the Exec functions. > To be completely explicit: because of the system object compatibility that > Wouter has implemented, you only need to avoid calling methods on such a > node. So you can borrow the code from Src/Tools/AmigaLib/lists.e, and be > careful in the other methods. You're making the data PRIVATE, aren't you? No, as said, the advantage is to use the node methods (while keeping the easy access to nodes through mlkn.succ or mlkn.pred). > > Can anyone explain me how I can obtain objects with methods that have not > > changed offsets with respect to the AmigaOS C includes? > > Wouter documents this in Ch14D of E.guide, as I said above. I should have a better look at it then. Thanks a lot. M&F @endnode @node ID45_4 "E Objects (ID45_4)" From: jason@fsel.com ("Jason Hulance") Subject: RE: E Objects Date: Tue, 24 Nov 1998 13:11:23 -0000 mauro fontana quoted and wrote: > > Wouter does skimp a bit on documentation, but the obvious > > implication is that writing an OBJECT with the same elements (not using > > "OF") will *not* be compatible. In fact, nowhere else does the E.guide > > suggest any correspondence of an OOP OBJECT with a simple OBJECT. So > > you shouldn't have assumed any. > > Well, he even does not say they are different 8)... so I presumed no > changes where done to objects with methods. For him to mention that there *is* a way to remain (pointer) compatible with system objects is about the best you could hope for, from Wouter. He's not keen on documentation. He'd much rather be doing the difficult stuff... > > This is tricky, since the normal Exec lists treat the list header > > like two nodes, overlaid in the same memory. So, no, you wouldn't > > think it was possible to mimic this directly using OOP OBJECTs. But > > you can, if you're careful, since you should be wrapping the classes > > so that you *never* treat the "node" parts of the list header as OOP > > nodes ("mlkn" in your example). Remember: you (should) *never* need > > to. > > You got the point. I wanted the OOP link class to be able to access > successive/preeceding nodes and, of course, at least use their methods. > But it seems this is not possible to do this and keeping compatibility > with the Exec functions. No, it's not possible without hiding the links. The lh data structure and it's relation to ln is compact and ingenious, but flipping awful in terms of flexibility. You will be hard pushed to find *any* OO language that can support this and remain compatible with the pointer data. > > To be completely explicit: because of the system object compatibility > > that Wouter has implemented, you only need to avoid calling methods on > > such a node. So you can borrow the code from > > Src/Tools/AmigaLib/lists.e, and be careful in the other methods. > > You're making the data PRIVATE, aren't you? > > No, as said, the advantage is to use the node methods (while keeping the > easy access to nodes through mlkn.succ or mlkn.pred). Well, that does it then. You can't mimic an overlaid lh and have Exec and pointer compatibility. Hiding the links is the only sane option. Cheers! - -- Your numbers are 75, 6, 9, 7, 1 and 5. The target is 678. The conundrum for today is "tnesaopos" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID46_0 "Kicking myself in public (was: EasyGUI/E problem, or something (ID46_0)" Date: 24 Nov 98 04:00:34 -0500 From: victord@netrover.com ("Victor Ducedre") Subject: Kicking myself in public (was: EasyGUI/E problem, or something larger?) [Hopefully I haven't put this off long enough that nobody can follow along anymore. Either way, it's 4 AM, I'm dead tired, and I can't help but ROTFL at my own stupidity :)] Quoting myself and Ali Graham (in some order)... :) >>> I've actually simplified the GUI definition to *one* element, and >>> The Problem still lives... (sigh) >>ow. :( How about the various options passed to guiinitA()? Is any of >>those causing it? Are you using any PLUGINs that haven't been >>recompiled against other sources that have changed? (this could >>probably throw things off even if they weren't actually used by the >>program, as EC would get its offsets in a twist while compiling...) > There are no plugins, and changing the options does nothing. but finishing off the options taglist with a TAG_DONE does amazing things... Apologies to Ali and Jason and anyone else who gave my problem even a moment of consideration, assuming it to be genuine. I hope the humour of it all makes up for it. :-) - -- Victor Ducedre (victord@netrover.com) Team AMIGA Now proud keeper of the XPKatana spell (v 1.4 on its way). "You spelled 'ballon' and 'vodoo' wrong," Tom said morosely. @endnode @node ID46_1 "Kicking myself in public (was: EasyGUI/E problem, or something (ID46_1)" Date: Tue, 24 Nov 1998 09:06:10 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Kicking myself in public (was: EasyGUI/E problem, or something larger?) Victor Ducedre wrote: > but finishing off the options taglist with a TAG_DONE does amazing > things... > > Apologies to Ali and Jason and anyone else who gave my problem even a > moment of consideration, assuming it to be genuine. I hope the humour > of it all makes up for it. :-) Don't kid yourself, the most stupid bugs are the hardest to find... because they are stupid and they aren't considered in your mind. its even worse when a stupid bug does some not so stupid bugs... like a program crash... ;-) Don't worry, I'm pretty sure we've all done this at least once... maybe even unknowingly... - -|\/|axim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode @node ID46_2 "Kicking myself in public (was: EasyGUI/E problem, or something (ID46_2)" From: jason@fsel.com ("Jason Hulance") Subject: RE: Kicking myself in public (was: EasyGUI/E problem, or something larger?) Date: Wed, 25 Nov 1998 07:54:09 -0000 Victor Ducedre wrote: > > There are no plugins, and changing the options does nothing. > > but finishing off the options taglist with a TAG_DONE does amazing > things... > > Apologies to Ali and Jason and anyone else who gave my problem even a > moment of consideration, assuming it to be genuine. I hope the humour > of it all makes up for it. :-) Is this connected to the problem you (very recently) brought to my attention? Need I still investigate it? [As you can tell, I didn't get any time at the weekend to look at it...] Cheers! - -- Your numbers are 75, 6, 9, 7, 1 and 5. The target is 678. The conundrum for today is "tnesaopos" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID46_3 "Kicking myself in public (was: EasyGUI/E problem, or something (ID46_3)" Date: 25 Nov 98 04:50:26 -0500 From: victord@netrover.com ("Victor Ducedre") Subject: RE: Kicking myself in public (was: EasyGUI/E problem, or something larger?) >Victor Ducedre wrote: >> Apologies to Ali and Jason and anyone else who gave my problem even a >> moment of consideration, assuming it to be genuine. I hope the humour >> of it all makes up for it. :-) >Is this connected to the problem you (very recently) brought to my >attention? Need I still investigate it? [As you can tell, I didn't >get any time at the weekend to look at it...] It is slightly related, in that the problem was found while trying everything imaginable to stomp out my Enforcer hits. The OPTI-compiled module works fine, and that's what I'm going to use. The problem *does* still exist in the non-OPTI compile, as near as I can tell, and I really don't know if it means anything or not. I'm going to quit while I'm ahead. Investigating it now doesn't really seem necessary, other than satisfying curiosity about the cause and reason. :) Thanks for the attention, though... - -- Victor Ducedre (victord@netrover.com) Team AMIGA Now proud keeper of the XPKatana spell (v 1.4 on its way). I was emperor for an hour, I had nothing else to do. @endnode @node ID47_0 "Problem with IF/ELSEIF (ID47_0)" Date: Wed, 25 Nov 1998 11:37:58 +0100 (CET) From: szczepan@student.man.bialystok.pl ("Marcin Juszkiewicz (Szczepan/BlaBla)") Subject: Problem with IF/ELSEIF In my program (MutiViewPrefs) I must split tooltypes list into few lists. I do it in long IF/ELSEIF/ELSE/ENDIF but I have one problem - part with ELSE not working. My source is : - -> sOurce DEF tmp[256] : STRING, dobj : PTR TO diskobject, oldtooltypes[700] : LIST, mem, a, b IF dobj := GetDiskObject(projname) oldtooltypes := dobj.tooltypes IF oldtooltypes mem := NIL WHILE oldtooltypes[mem] <> NIL StrCopy(tmp,oldtooltypes[mem]) b := Val(tmp,NIL) IF InStr(tmp,'IM1=',0) > -1 isnitt := TRUE a := newicon.add(tmp) ELSEIF InStr(tmp,'IM2=',0) > -1 isnitt := TRUE a := newicon.add(tmp) ELSEIF InStr(tmp,'EDIT THE FOLLOWING LINES',0) > -1 isnitt := TRUE a := newicon.add(tmp) ELSEIF InStr(tmp,'DEFAULTIMAGE',0) > -1 isnitt := TRUE a := newicon.add(tmp) ELSEIF b > NIL a := fidnode.add(tmp) ELSEIF StrCmp(tmp,'DEF',3) a := defnode.add(tmp) ELSEIF StrCmp(tmp,'SHOWINFO',8) IF StrCmp(tmp,'SHOWINFO=NO') showinfo := FALSE ELSE showinfo := TRUE ENDIF ELSEIF StrCmp(tmp,'.',1) a := extnode.add(tmp) ELSEIF a := InStr(tmp,'.') IF (a > -1) AND (a < 10) THEN a := extnode.add(tmp) ELSE - -> this part isn't working !!! a := dtnode.add(tmp) ENDIF mem++ ENDWHILE ENDIF FreeDiskObject(dobj) ENDIF - ------ Marcin Juszkiewicz (Szczepan/BlaBla) *Team Amiga* szczepan@infeco.pb.bialystok.pl http://student.man.bialystok.pl/szczepan/ A1200 BlizzIv 2+8MB RAM 425MB HDD x8 CD Author of MultiView for OS 2.0+ -> Aminet:util/sys/2b_mv_os2_x.lha @endnode @node ID47_1 "Problem with IF/ELSEIF (ID47_1)" Date: Wed, 25 Nov 1998 14:24:27 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Problem with IF/ELSEIF On Wed, 25 Nov 1998, Marcin Juszkiewicz (Szczepan/BlaBla) wrote: > In my program (MutiViewPrefs) I must split tooltypes list into few lists. > I do it in long IF/ELSEIF/ELSE/ENDIF but I have one problem - part with > ELSE not working. My source is : > IF dobj := GetDiskObject(projname) > oldtooltypes := dobj.tooltypes > IF oldtooltypes > mem := NIL > WHILE oldtooltypes[mem] <> NIL > StrCopy(tmp,oldtooltypes[mem]) This comparison just does nothing > > b := Val(tmp,NIL) > > IF InStr(tmp,'IM1=',0) > -1 > isnitt := TRUE > a := newicon.add(tmp) > ELSEIF InStr(tmp,'IM2=',0) > -1 > isnitt := TRUE > a := newicon.add(tmp) > ELSEIF InStr(tmp,'EDIT THE FOLLOWING LINES',0) > -1 > isnitt := TRUE > a := newicon.add(tmp) > ELSEIF InStr(tmp,'DEFAULTIMAGE',0) > -1 > isnitt := TRUE > a := newicon.add(tmp) > > ELSEIF b > NIL > a := fidnode.add(tmp) > > ELSEIF StrCmp(tmp,'DEF',3) > a := defnode.add(tmp) > ELSEIF StrCmp(tmp,'SHOWINFO',8) > IF StrCmp(tmp,'SHOWINFO=NO') > showinfo := FALSE > ELSE > showinfo := TRUE > ENDIF > > ELSEIF StrCmp(tmp,'.',1) > a := extnode.add(tmp) > ELSEIF a := InStr(tmp,'.') Change the a:= to = otherwise the assignment is always TRUE > IF (a > -1) AND (a < 10) THEN a := extnode.add(tmp) > > ELSE > > -> this part isn't working !!! > > a := dtnode.add(tmp) > ENDIF > mem++ > > ENDWHILE > ENDIF > FreeDiskObject(dobj) > ENDIF M&F @endnode @node ID47_2 "Problem with IF/ELSEIF (ID47_2)" From: jason@fsel.com ("Jason Hulance") Subject: RE: Problem with IF/ELSEIF Date: Wed, 25 Nov 1998 14:20:33 -0000 Marcin Juszkiewicz (Szczepan/BlaBla) wrote: > In my program (MutiViewPrefs) I must split tooltypes list into few lists. > I do it in long IF/ELSEIF/ELSE/ENDIF but I have one problem - part with > ELSE not working. My source is : [...Snip...] > ELSEIF StrCmp(tmp,'.',1) > a := extnode.add(tmp) > ELSEIF a := InStr(tmp,'.') > IF (a > -1) AND (a < 10) THEN a := extnode.add(tmp) > > ELSE > > -> this part isn't working !!! > > a := dtnode.add(tmp) > ENDIF The InStr() comparison (in the second ELSEIF above) will only yield FALSE (i.e., zero) if the '.' is found at the beginning of the string. But that's exactly what the preceding StrCmp() tests. So the ELSE part will never be reached. Perhaps you meant: ... ELSEIF (a:=InStr(tmp,'.')) <> -1 ... Cheers! - -- Your numbers are 100, 4, 3, 10, 6 and 7. The target is 258. The conundrum for today is "soimipaxh" ====================================================================== Jason R. Hulance Email: jason@fsel.com Formal Systems (Europe) Ltd Tel: [+44] (0)1865 728460 Keble Court, 26 Temple St, Oxford OX4 1JS Fax: [+44] (0)1865 201114 @endnode @node ID47_3 "Problem with IF/ELSEIF (ID47_3)" Date: Wed, 25 Nov 1998 16:28:32 +0100 From: gamboni@fastnet.ch (Maxime Gamboni) Subject: Re: Problem with IF/ELSEIF mauro fontana a =E9crit: > On Wed, 25 Nov 1998, Marcin Juszkiewicz (Szczepan/BlaBla) wrote: > > > In my program (MutiViewPrefs) I must split tooltypes list into few l= ists. > > I do it in long IF/ELSEIF/ELSE/ENDIF but I have one problem - part wi= th > > ELSE not working. My source is : [...] > > ELSEIF a :=3D InStr(tmp,'.') > > Change the a:=3D to =3D otherwise the assignment is always TRUE This is not quite right. when you use an assignment as an expression (lik= e here), it returns the value that was assigned to the variable. For instan= ce, WriteF('a is \d\n',(a:=3D36)) outputs 'a is 36' [...] Maxime @endnode @node ID47_4 "Problem with IF/ELSEIF (ID47_4)" Date: Wed, 25 Nov 1998 16:51:51 +0100 (MET) From: mfontana@komodo.ing.unico.it (mauro fontana) Subject: Re: Problem with IF/ELSEIF > > Change the a:= to = otherwise the assignment is always TRUE > > This is not quite right. when you use an assignment as an expression (like > here), it returns the value that was assigned to the variable. For instance, > WriteF('a is \d\n',(a:=36)) outputs 'a is 36' > [...] Oh, yes, that's right. Shame on me, and on my E knowledge... (I should study a bit more 8) ). M&F @endnode @node ID47_5 "Problem with IF/ELSEIF (ID47_5)" Date: Thu, 26 Nov 1998 10:45:20 +0100 (MET) From: szczepan@student.man.bialystok.pl ("Marcin Juszkiewicz (Szczepan/BlaBla)") Subject: Re: Problem with IF/ELSEIF On Wed, 25 Nov 1998, mauro fontana wrote: - ->> WHILE oldtooltypes[mem] <> NIL - ->> StrCopy(tmp,oldtooltypes[mem]) - -> - ->This comparison just does nothing oldtooltypes is ended by NIL - ->> ELSEIF a := InStr(tmp,'.') And here I changed code.. to ELSEIF (Instr(tmp,'.') > -1) AND (Instr(tmp,'.') < 10) and it works - ------ Marcin Juszkiewicz (Szczepan/BlaBla) *Team Amiga* szczepan@student.man.bialystok.pl http://student.man.bialystok.pl/szczepan/ A1200 BlizzIv 2+8MB RAM 425MB HDD x8 CD Author of MultiView for OS 2.0+ -> Aminet:util/sys/2b_mv_os2_x.lha @endnode @node ID48_0 "NewIcon copy! (ID48_0)" From: david.lidstrom@home.se (David =?iso-8859-1?Q?Lidstr=F6m?=) Date: Fri, 27 Nov 1998 09:57:12 +0100 Subject: NewIcon copy! Hello folks! I'm making a minor program called MrIcon, though the NewIcon copy stuff bothers me! When I copy the newicon, and the close the = program a guru pops up! But not when I copy the "normal" image, so I suppose it's this part that contains an error! I guess to copy the images like I do in the example is both illegal and stupid! :\ But how shall I do it? I have no idea?! Please help! The Example: - ------- IF newicon_m=3DNEWICON newdobj_dest.normalimage:=3Dnewdobj_source.normalimage newdobj_dest.selectedimage:=3Dnewdobj_source.selectedimage n:=3DPutNewDiskObject( noInfo(dest_name), newdobj_dest) FreeDiskObject(newdobj_dest); newdobj_dest:=3D0 loadRightDest(dest_name) ELSE = ... ENDIF - -------- Thnx! :) - -- = Current track: Mortification - Blood Sacrifice ________________ David Lidstr=F6m Buisness page: Marsv=E4gen 2 http://www.pang-pang.com 642 33 FLEN ICQ UIN: 15268371 Webring: SWEDEN http://listen.to/gods.music Tfn 0739/70 68 55 Homepage: = http://hem1.passagen.se/noamon If at first you don't succeed, destroy all evidence that you tried. ______ @endnode @node ID49_0 "MuiCursor (ID49_0)" From: dave@shaye.demon.co.uk ("Dave Denton") Date: 27 Nov 98 18:29:16 +0000 Subject: MuiCursor Hi All, Can anyone tell me how to link the cursor keys to buttons in mui, like they are in most web browers. Cheers Dave @endnode @node ID50_0 "Old ideas - Frontend (ID50_0)" From: sanric@ronet.it (Riccardo Santato) Date: Fri, 27 Nov 1998 18:32:56 +0100 Subject: Old ideas - Frontend Hello Sven Il 23-Nov-98, Sven Steiniger scrisse: > The best thing would be writing an frontend for > gcc. This would add portability and an excellent > optimizer but reduces compiling speed (compared > to EC). I have no experiences in writing such > front ends but it is possible (Fortran and Java > frontend exists). One year ago I started "Planet - E" which in my intention was a perfect environment for E. I stopped it because it was gettin' too large for a single coder !! > A good start would be an lexical parser (yacc) > for E Do you mean something like the one for GoldED ? > I suppose that the real trouble starts with the > built-in functions (OpenW() etc.) and ends with > OO-concept. NO MORE HARDWARE BANGING INTUITION FUNCTIONS !! EVERYTHING MUST BE CODED IN A SYSTEM COMPLIANT WAY. This means that if we have to open a Screen, we must use REAL Intuition functions (or MACROs ) > And there are even more things to discuss. > So whenever the FreE project starts you can add > me to the list of (C/E) programmers. Welcome !!!! ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID51_0 "THANK YOU ALL !!! (ID51_0)" From: sanric@ronet.it (Riccardo Santato) Date: Fri, 27 Nov 1998 20:41:33 +0100 Subject: THANK YOU ALL !!! Warning: This is a message in MIME format. Your mail reader does not support MIME. Some parts of this message will be readable as plain text. To see the rest, you will need to upgrade your mail reader. - --BOUNDARY.2015346360.3 Content-Type: text/plain Hello World. I returned home after a week of university (I study quite far from my city and this means that I must live there 5 days a week) and... what a surprise !! I never thought my idea of a free E compiler would have gained such a success. Very well, maybe we can do something serious, but before we go on we have to build the team. That's why I attached a .lha archive which contains the text for the subscription to the project : there's written everything you wanna know, the real base of this work. Read it and tell me what U think 'bout it !! Kind regards ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== - --BOUNDARY.2015346360.3 Content-Type: application/x-lha; name="Subscription.lha" Content-Disposition: attachment; filename="Subscription.lha" Content-Transfer-Encoding: base64 Content-Description: READ THIS !! JmctbGg1LWAGAAAnHQAAsqN7JQIAEFN1YnNjcmlwdGlvbi50eHR3SQU2c5rusban+x9+AP8k wLIGx0CgYDwhxvZa6OPYnrchUIQvPd82/Wbu+fe9u2SCPjf+/+1xyWW0kitlVKShgFQJAqrg AkIRglwqYFReXLsjsLsbsPku7H7MPhl3wLvbw9Y222+L0fPf3KGjxfeMb0dHkFvUUP4KHcC8 3j3CBxgnM+X/BQ4ObkV3ylDgHdHR5GYf6KHeIHaG+Yy/YUC7ZD42wf9KHNGD/socsbH1FDyS U8jQ/1l6/sUPDEP+hQ55Pv+FDwUbf/FDv1YO6UPP9mKHr+b57so7Dq9WCzfrjxg1NZbJixLY XXWqdU+MqMiS0NZiYNAsrF9dMdD39UNesw3bVu/bhuxV3nva0yvg7NpwtjYrLQpc5WoYIrvQ vlbu7MNzZgKxdKACkOvbs9SxcLWggrkhrkunRMY5jxpbQ5J09hLN6jIanbipZSwpKQccq8qZ C69IBTXExrLKlDaWJJeI1uxsRNMBasZFt4i3l0sJU9CZ3ImoG9ZJQycplzp3ixMXMCOOfMyu tWcNOKyQoZqDFg1YrN63qwViee9upatzIuUf6tm3wJCptDFYaaAkap3I6O+WQ1l1r0EG1YvQ FMmRSHLHbCKsnTQ+Vm0Ua5ZQfQkbQwiPIYnoWApKaCiTRoP6GulNBsP2AnsrdB8k0RuSrYwa ty3ZCVa9i3dJbMaJ1fKiolORrIjsJNdmpHpvrXJTHQS55d4kVNymRjBsVGiUEMl5avIN1VGk I8G5ZWDyrPPdLTCdgEkSwytMjbTxNCJiUShAsMqXyQQURU1MxT0zYQIh0/teyGDH6NcedfBF fNn6I8ig+SQJrRkNFjcHQXuA+yGFqnaqRNYN+VmVnKlkyqCqae2ZAaGcg+F0DroQw+R8PqED 9AhbDP83qvKEVDIX25UpNSFTBPewmYQUNee9wLFR0GhSf6UqYESQXThhtFtzr3JUyY3Q3Bz2 NBQF0q3SLDvFtLD+WFsonKFbKJktamd9yNBkuWluSqOtO4FQmyqlqZ8ozPKoKOFUyJnKRZvm wpoRmTJz5fg7J5dHwxU8ahFO0+FY4mFKifHSgSi54Q7Fqw+Vy3FsP60N6/esXXzJln2PYfEx 8VvUsvlrw2sFyxqe2OGLXfLq2NkCXVMO6hyXultRIcA0hx/+7piIJjVznA6ihDc8f5scnNhM GzBe6xa8GvqwXih1iv9SAti9CdLN81yCRsQI/UmhaDWo2cHIEjCtjouhDN72mc4DVzJwrk3i paFWDW14sSRAQI0t9bXy6kHRiBj2rdy4VjBfEhN+3ZsXLnWLVgc4DBdzzh2t+fNJY2Lpy1ig 4KNmVgjvXS0SLB3lBpYYR2YrXGS7DfMtXoL+C9dBS9aqdGgowkIYUEsFANzqBRjVOPSg+TFT KFZz/VUoCRjYk5QktOWmeRVU3j+/SFxKdNwfgmWRoMEq9wMLkNJJHdL1Cd00urveK2Lqdz7n EPmJqJxPz77BKXRWCj/N5TF4hHSvKjjQyRZRCBhFC9PMyHU9d38VnBfD5RU//Pgee60EQpIY jhsFRM33ilTUz/hbtb37Y2FzkyO6UWxVTafOknIccedMHsyYh690Wxq/GrnyeP56Klk/IQvt H3k6kyFSia2Rgo+9FLa/4EDvOd/yPvbScJZROkWkJPBRNTJp1/vIEMcdOV1EGv+KAvfA6mLn qk1+Ugl8XxlsihoWNa5CP1z+F1dApZ5vfwZKn5E/0E70k/MUHrfQkFtXbdg8HlM8FXA7S2kd PY6lYwZds71M+a9JkHGgmiZsYrseRYs6igVscGOwbjwd6rvcMTsdtmJEZzm7+REw7/73Pnpg iQbqYwgssre30dPW+Grn8I8McCl1DPiIY6LTsTT6RyLIg8FeVWFvCPDoqvk8cTHGQs7Axk7D HNGYIMt0XWGyikczkELyWjMOGOdfYiPbNmJcDM3uVj8aas8sOWklcIfQH9M3RoZVaZ3hUV3S 38VflDu6tOeYi8kKOeQaeaHX4WuYaRpyLW5mUYrg8i2Z1Bn7Cha3PHV+sMhxYlRqGGtaXGMN ViqE98LAFSZVdRq8Ddfn2DOb52EpxS6CTjtTC/yQe+33dRM7Kgd934OeeA8QFRVbDR3nq/kr pc9p71Eb0EZ6xVg9lpCsnW0/2wP//jj2xkGawe47wsz+4d8+ZA96fxgHFgJfuUfUUPMUAAA= - --BOUNDARY.2015346360.3-- @endnode @node ID51_1 "THANK YOU ALL !!! (ID51_1)" From: eq3nmf@eq.uc.pt (Nuno Maltez) Date: Sun, 29 Nov 1998 12:45:46 +0100 Subject: Re: THANK YOU ALL !!! Hi Riccardo, > !! I never thought my idea of a free E compiler would have gained such a > success. > Very well, maybe we can do something serious, but before we go on we have > to build the team. > That's why I attached a .lha archive which contains the text for the > subscription to the project : there's written everything you wanna know, > the real base of this work. I think you should also contact Gregor Goldbach beause he had already started to write a new E compiler and, IIRC, actaully had some stuff working already. Regards - -- Nuno @endnode @node ID52_0 "Old ideas - assembly ? (ID52_0)" From: sanric@ronet.it (Riccardo Santato) Date: Fri, 27 Nov 1998 20:42:01 +0100 Subject: Old ideas - assembly ? Hello Tommy Il 22-Nov-98, Tommy Lindgren scrisse: > I agree. But we need someone who can assembler... :-/ With the power of ... 1) StormC++ (which optimizes and is well supported by many other tools) 2) GNU C++ (probably the biggest and more portable C compiler in the universe) 3) VBCC (free, fast, doesn't require Gigas of freemem and compiles for PPC) who still needs assemblers ? With the coming of PPC, you can forget LEA, MOVE, DC.B and etc... - -- ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID52_1 "Old ideas - assembly ? (ID52_1)" From: tommy@pitea.mail.telia.com (Tommy Lindgren) Date: Sun, 29 Nov 1998 14:10:14 +0200 Subject: Re: Old ideas - assembly ? Hello Riccardo On 27-Nov-98, you wrote: > Hello Tommy > Il 22-Nov-98, Tommy Lindgren scrisse: >> I agree. But we need someone who can assembler... :-/ > With the power of ... > 1) StormC++ (which optimizes and is well supported by many other too= ls) > 2) GNU C++ (probably the biggest and more portable C compiler in the= > universe) > 3) VBCC (free, fast, doesn't require Gigas of freemem and compil= es for > PPC) > who still needs assemblers ? With the coming of PPC, you can forget LEA= , MOVE, > DC.B and etc... = Okay, I admit, the word "assembler" was an "automatic" reaction of the se= ntence = "code a new compiler". My expirence of C compilers is bad, IMHO ther're s= low and the output files are giantic (compared with E and assembler). The best "feature" (IMHO) with E is its compilation speed. I *hate* to wa= it more than five seconds just because of some silly misspell... = Has Wouter no future plans for E? = - -- = Tommy Lindgren - tomyl@telia.com http://w1.911.telia.com/~u91103938 = ICQ UIN: 13659426 = Famous people swearing... Einstein: Any f%*ker can understan that @endnode @node ID52_2 "Old ideas - assembly ? (ID52_2)" From: sanric@ronet.it (Riccardo Santato) Date: Sun, 29 Nov 1998 16:29:17 +0100 Subject: Re[2]: Old ideas - assembly ? Hello Tommy Il 29-Nov-98, Tommy Lindgren scrisse: > Okay, I admit, the word "assembler" was an "automatic" reaction of the sentence > "code a new compiler". My expirence of C compilers is bad, IMHO ther're slow and > the output files are giantic (compared with E and assembler). Compiling speed in C++ environments can be made faster using .o objects instead of .h ones, like we normally do in E. To obtain these files just compile without link. It's the same thing that E does. > The best "feature" (IMHO) with E is its compilation speed. I *hate* to wait more > than five seconds just because of some silly misspell... I know it's very boring. E is fast, really, but it doesn't optimize a thing, while C compilers do. If someone wants to create a small application, E is the best choice, but for large projects (like FreE) better prefere more solid languages. > Has Wouter no future plans for E? It's the second time I suggest the idea of creating a new compiler, but Wouter never entered in the question. Maybe he is not so interested in new versions, because they would cost him the passage from old-style assembly to new-style C++ (are there other way to make E outputs code for PPC ?!?) See U soon ! ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID52_3 "Old ideas - assembly ? (ID52_3)" Date: Mon, 30 Nov 1998 11:59:56 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: Re: Old ideas - assembly ? Riccardo Santato wrote: > > > Has Wouter no future plans for E? > > It's the second time I suggest the idea of creating a new compiler, but Wouter > never entered in the question. Maybe he is not so interested in new versions, > because they would cost him the passage from old-style assembly to new-style > C++ (are there other way to make E outputs code for PPC ?!?) Not Really, Wouter does not belong to this list AFAIK. Too Busy. But As I said before he is (at least was in May) willing to port it to OS 5. He is waiting until then to say announce anything I think. He Really likes Amiga so I Think he'll want to port his toolset to the next generation. But his main problem is time... He is VERY busy and is actively working on the University stuff, so i guess the PD is much less important in his life right now. Especially since The new OS isn't out yet! Putting alot of time is somewhat of wasted time. One of the reaons E compiles so fast is because its written 100% in assembly. Thus making a new E compiler will Certainly be slower in compilation time. Can I wish for it to still be a cli-based compiler (but with more options of course.) cause it makes it much easier to interface with external environments... I for example NEVER enter a CLI when I compile... I just use a one-line script which is executed by IconX command... simple and easy. just build one Icon per e file. you can even make multiple-Compile scripts which take care of dependencies and mimic a Build tool in C. > > See U soon ! > > ====================================================== > Santato Riccardo > > sanric@ronet.it > www.geocities.com/SunsetStrip/Stage/6141/ > ===================================================== > > @endnode @node ID52_4 "Old ideas - assembly ? (ID52_4)" From: tommy@pitea.mail.telia.com (Tommy Lindgren) Date: Mon, 30 Nov 1998 19:11:26 +0200 Subject: Re: Old ideas - assembly ? Hello Riccardo On 29-Nov-98, you wrote: [snip] >> The best "feature" (IMHO) with E is its compilation speed. I *hate* to wait >> more than five seconds just because of some silly misspell... > I know it's very boring. E is fast, really, but it doesn't optimize a thing, > while C compilers do. Really? Do you mean in size or speed? A simple "Hello, world!" program in E becomes ~700 bytes large. In gcc it becomes >2000 bytes. (okay, I don't know if gcc is good or bad compiler) - -- Tommy Lindgren - tomyl@telia.com http://w1.911.telia.com/~u91103938 ICQ UIN: 13659426 Just because everything is different doesn't mean anything has changed. - Southern California Oracle - @endnode @node ID52_5 "Old ideas - assembly ? (ID52_5)" Date: Mon, 30 Nov 1998 18:52:18 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Old ideas - assembly ? On Mon, 30 Nov 1998, Tommy Lindgren wrote: =>> I know it's very boring. E is fast, really, but it doesn't optimize a thing, =>> while C compilers do. => =>Really? Do you mean in size or speed? A simple "Hello, world!" program in =>E becomes ~700 bytes large. In gcc it becomes >2000 bytes. (okay, I don't =>know if gcc is good or bad compiler) Code generated by E uses the Amiga Operating system. Code generated by GCC uses ixemul, and fights against the Amiga OS, as it's pretending to be a UNIX C compiler and UNIX C environment rather than be a 'native' compiler. The actual code generated by GCC is quite good, but it is wasted by having tons and tons of unneccesary UNIX emulation stubs/libraries added. Do something clever in E in one procedure and compile it as a module. Do the same thing in C in one function and compile it with the -c option. You should then get a 'fair' comparison. Stuart @endnode @node ID52_6 "Old ideas - assembly ? (ID52_6)" From: sanric@ronet.it (Riccardo Santato) Date: Wed, 02 Sep 1992 13:03:13 +0100 Subject: Re[2]: Old ideas - assembly ? Hello Maxim Il 30-Nov-98, Maxim Olivier-Adlhoch scrisse: > Not Really, Wouter does not belong to this list AFAIK. Too Busy. But > As I said before he is (at least was in May) willing to port it to OS > 5. He is waiting until then to say announce anything I think. He > Really likes Amiga so I Think he'll want to port his toolset to the next > generation. But his main problem is time... He is VERY busy and is > actively working on the University stuff, so i guess the PD is much less > important in his life right now. Especially since The new OS isn't out > yet! Putting alot of time is somewhat of wasted time. AFAIK the new OS is still far away from completion while PPC processors are our reality. > One of the reaons E compiles so fast is because its written 100% in > assembly. Thus making a new E compiler will Certainly be slower in > compilation time. It's not true that everything written in ASM is fast ! It depends from the guy who stands behind the console. > Can I wish for it to still be a cli-based compiler (but with more > options of course.) cause it makes it much easier to interface with > external environments... Yes, the idea is good . When I talk about a new environment, I mean something like StormC or SAS/C: an editor which calls an external compiler,debugger,profiler... > I for example NEVER enter a CLI when I compile... I just use a one-line > script which is executed by IconX command... simple and easy. That's one of best thing of Amiga: simplicity. - -- ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID52_7 "Old ideas - assembly ? (ID52_7)" From: sanric@ronet.it (Riccardo Santato) Date: Wed, 02 Sep 1992 13:07:54 +0100 Subject: Re[2]: Old ideas - assembly ? Hello Tommy Il 30-Nov-98, Tommy Lindgren scrisse: > Really? Do you mean in size or speed? A simple "Hello, world!" program in > E becomes ~700 bytes large. In gcc it becomes >2000 bytes. (okay, I don't > know if gcc is good or bad compiler) Both. Even in StormC (which is the BEST environment for coding on Amiga) the executables are large, but when a program or an application is astoundingly fast, do you read the number of Kbytes it eats on your HD ? Personally I'd prefer "Quake" to be bigger in size but faster than the contrary... CU ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID52_8 "Old ideas - assembly ? (ID52_8)" From: sanric@ronet.it (Riccardo Santato) Date: Wed, 02 Sep 1992 13:09:49 +0100 Subject: Re[2]: Old ideas - assembly ? Hello Stuart Il 30-Nov-98, Stuart Caie scrisse: > Code generated by E uses the Amiga Operating system. Code generated by > GCC uses ixemul, and fights against the Amiga OS, as it's pretending to > be a UNIX C compiler and UNIX C environment rather than be a 'native' > compiler. The actual code generated by GCC is quite good, but it is > wasted by having tons and tons of unneccesary UNIX emulation > stubs/libraries added. I'm not so sure but it seems to me that ,before compiling, GCC asks you wether to use ixemul or not. Am I right ? Regards - -- ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID52_9 "Old ideas - assembly ? (ID52_9)" Date: Mon, 30 Nov 1998 13:58:32 -0800 From: dobes@mindless.com (Dobes Vandermeer) Subject: Re: Old ideas - assembly ? Tommy Lindgren wrote: > > Hello Riccardo > > On 29-Nov-98, you wrote: > > [snip] > > >> The best "feature" (IMHO) with E is its compilation speed. I *hate* to wait > >> more than five seconds just because of some silly misspell... > > > I know it's very boring. E is fast, really, but it doesn't optimize a thing, > > while C compilers do. > > Really? Do you mean in size or speed? A simple "Hello, world!" program in > E becomes ~700 bytes large. In gcc it becomes >2000 bytes. (okay, I don't > know if gcc is good or bad compiler) Size vs. speed, they are different problems. GCC generates much larger code because it does everything in a very portable way, which leads to lots of extra info being added to the file and stuff. E does in fact optimise code, but it does not have a very extensive optimiser. GCC has varying levels of optimisation, but even it does not sport some of the fancier optimisation techniques, mostly because they are very difficult to apply to C code. CU DObes @endnode @node ID52_10 "Old ideas - assembly ? (ID52_10)" Date: Mon, 30 Nov 1998 14:13:09 -0800 From: dobes@mindless.com (Dobes Vandermeer) Subject: Re: Old ideas - assembly ? Riccardo Santato wrote: > > Hello Stuart > > Il 30-Nov-98, Stuart Caie scrisse: > > > Code generated by E uses the Amiga Operating system. Code generated by > > GCC uses ixemul, and fights against the Amiga OS, as it's pretending to > > be a UNIX C compiler and UNIX C environment rather than be a 'native' > > compiler. The actual code generated by GCC is quite good, but it is > > wasted by having tons and tons of unneccesary UNIX emulation > > stubs/libraries added. > > I'm not so sure but it seems to me that ,before compiling, GCC asks you wether > to use ixemul or not. > Am I right ? You can change its settings to use libnix instead of ixemul. However, libnix isn't quite as good as ixemul, and stuff. CU Dobes @endnode @node ID53_0 "Old ideas - Syntax (ID53_0)" From: sanric@ronet.it (Riccardo Santato) Date: Fri, 27 Nov 1998 18:37:17 +0100 Subject: Old ideas - Syntax Hello Maxim Il 23-Nov-98, Maxim Olivier-Adlhoch scrisse: > The reason I program in E is because of its syntax. because it is typeless and because > it remains simple AND fast. Being typeless is either an advantage or a bad thing ! Read in the list how many problems this causes every day !! > There are many things that E programmers take for granted that C programmers would like > to get. PLEASE for the sake of the Language itself, do not change the syntax. writing > := instead of = is not a big issue warranting the rewrite of a language. I've launched the idea of a new COMPILER, not of a new LANGUAGE ! Everything will remain the same ! > I do admit that there are things MISSING and that Those should be addressed but Do not > make the actual systems different. That is one of the reasons I shun C++. many people > Think thay've got better ideas and change C/C++ syntax just a little... but then it makes > two sources COMPLETELY incompatible. I'd rather code with an older tool if that meant I > would not have to re-code my stuff. I've several 5000+ apploications and I'd really hate > to code everything again! No worries ! ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID54_0 "Old ideas - Java (ID54_0)" From: sanric@ronet.it (Riccardo Santato) Date: Fri, 27 Nov 1998 20:32:25 +0100 Subject: Old ideas - Java Hello Stuart Il 23-Nov-98, Stuart Caie scrisse: > A job for Java? No, for God's sake, NO JAVA. It's slow, boring, C++ similar and not conceived for our machines. ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID54_1 "Old ideas - Java (ID54_1)" Date: Mon, 30 Nov 1998 09:53:01 +0000 (BST) From: sac@csd.abdn.ac.uk (Stuart Caie) Subject: Re: Old ideas - Java On Fri, 27 Nov 1998, Riccardo Santato wrote: =>Il 23-Nov-98, Stuart Caie scrisse: => =>> A job for Java? => =>No, for God's sake, NO JAVA. It's slow, boring, C++ similar and not conceived =>for our machines. It's secure, portable to almost anywhere, full of functionality, NOT C++ (it's more 'how an object-oriented form of C would look if it was done properly instead of being done like C++') and it's not concieved for any machine, which removes a lot of hangups and problems. C code can use a lot of very ugly constructs and assumptions that do nothing but make room for bugs. Java takes a stand against these problems, and people call it slow. So what? I code in assembler most of the time, and I think that the code generated for C programs is slow. Do you want a portable compiler for the E language, or do you just want to use the optimiser and PPC code generation from other Amiga compilers? I'd like to know how you're going to implement E's exception handling, objects, lisp cells and lambda functions in ANSI C. Stuart @endnode @node ID54_2 "Old ideas - Java (ID54_2)" From: sanric@ronet.it (Riccardo Santato) Date: Wed, 02 Sep 1992 12:55:48 +0100 Subject: Re[2]: Old ideas - Java Hello Stuart Il 30-Nov-98, Stuart Caie scrisse: > Do you want a portable compiler for the E language, or do you just want to use > the optimiser and PPC code generation from other Amiga compilers? I think it's not so useful now to talk 'bout portability when the team have still to be formed ... Let's discuss it later. > I'd like to know how you're going to implement E's exception handling, objects, > lisp cells and lambda functions in ANSI C. Not ANSI C, but C++. I know C cannot handle classes (which are the real implementation of C++ towards C). BTW, who now does make use of lambda funtions and lisp-cells ? CU ====================================================== Santato Riccardo sanric@ronet.it www.geocities.com/SunsetStrip/Stage/6141/ ===================================================== @endnode @node ID54_3 "Old ideas - Java (ID54_3)" Date: Mon, 30 Nov 1998 21:24:23 +0000 (UTC) From: tsb@earth.li (Tim Bagot) Subject: Re: Re[2]: Old ideas - Java On Wed, 2 Sep 1992, Riccardo Santato wrote: > BTW, who now does make use of lambda funtions and lisp-cells ? I found quoted expressions really quite useful recently. I had a long list of expressions which could be selected just by Evaling the appropriate list item. I could have done this with a SELECT OF, but that seemed rather clumsy and inelegant in comparison. BTW, is there any reason why edbg won't trace inside SELECT OFs? Tim Bagot @endnode @node ID55_0 "Bitmap palette remapping (ID55_0)" From: chris@planb.thegap.com (Christopher Perver) Date: Sat, 28 Nov 1998 22:14:46 +0000 Subject: Bitmap palette remapping Hello everyone, I have decided not to bother with backfill hooks, as I think I can get away without using them. My question is does anybody know how to remap a bitmap palette to a screen palette without using datatypes? And if there aren't the right colours, and there are free pens available, changing them and locking them? Thanks. - -- Regards, Chris. He that believeth on the Son hath everlasting life: and he that believeth not the Son shall not see life; but the wrath of God abideth on him. John 3:36 http://www.jvim.com/ @endnode @node ID56_0 "Program output (ID56_0)" From: dissident@mail.telepac.pt (Roberto) Date: Sun, 29 Nov 1998 16:34:28 +0000 Subject: Program output Hi. How do i get output from a program? Lets say i run it with SystemTagList(), how do i get it's output? Another thing: how does Efindhit find the correct offset in the source files? - -- rOBERTo ->dissident@mail.telepac.pt<- ICQ:14501808 @endnode @node ID56_1 "Program output (ID56_1)" From: wozniak_m@mail.gwl.koszalin.tpnet.pl (Michal Wozniak) Date: Sun, 29 Nov 1998 19:56:23 +0300 Subject: Re: Program output Hello. On 29-Lis-98, Roberto wrote: > Hi. How do i get output from a program? Lets say i run it with > SystemTagList(), how do i get it's output? You can use Execute() from dos.library. There you can define input and output stream. > Another thing: how does Efindhit find the correct offset in the source > files? I think he is using DEBUG hunk. > Regards @endnode @node ID57_0 "INet225 (ID57_0)" From: dissident@mail.telepac.pt (Roberto) Date: Sun, 29 Nov 1998 15:42:49 +0000 Subject: INet225 Hey there! Has anyone translated the INet225 package to AmigaE modules? - -- rOBERTo ->dissident@mail.telepac.pt<- ICQ:14501808 @endnode @node ID58_0 "MUI OM_GET Method (ID58_0)" Date: Mon, 30 Nov 1998 12:54:19 -0500 From: max2@ordigraphe.com ("Maxim Olivier-Adlhoch") Subject: MUI OM_GET Method Hi All, I'm trying to implement an OM_GET method out of BOOPSI... The problem is that I seem to be unable to put the information I want into the opget structure in a way which will make it return the information corrrectly. The actual function I'm using is get() (but I think this is a #define for another function called etAttrs or something like that. cause When I get an error in this function that's the text displayed in the Con and I have nothing of that kind in my source. The problems are simple. 1) if I RETURN a value of MUI_TRUE from my OM_GET method, it Crashes the application ! 2) when I set the value of opget.storage to something, it is always returned as 0 by get. If I then dereference the pointer which opget.strorage currently points to and insert a value into that (see following): DEF ptr=0:PTR TO LONG (...snip...) ptr := opget.storage ptr[0] := value (...snip...) THen the value returned by get() has no bearing as to what value should be... I'm pretty mixed up by his one, but I guess any one which has done BOOPSI or MUI can set me strait in no-time :) I'm also wondering what function I should be using under E to get actuall Tags from my MUI classes... should I build all the opget stuff and call DoMethodA myself or are there simpler methods... The function get() seems to work for other object in my MUI tree, so I'm wondering why it wouldn't for my own custom class. PLUS, there are NO docs covering this in MUI nor are they very explicit in the RKRMs... unless someone can tell where to look :) - -|\/|axim - -- - ---------------------- Maxim Olivier-Adlhoch - ---------------------- max2@ordigraphe.com - ---------------------- Are you a programer... Then Visit STEEL(c) Web Site before you're left in the cold... http://www.geocities.com/SiliconValley/Network/7002/steel_welcome.html @endnode